KEGG   Kosakonia radicincitans: A3780_04180Help
Entry
A3780_04180       CDS       T04579                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
krd  Kosakonia radicincitans
Pathway
krd00473  D-Alanine metabolism
krd00550  Peptidoglycan biosynthesis
krd01100  Metabolic pathways
krd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:krd00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    A3780_04180
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A3780_04180
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    A3780_04180
Enzymes [BR:krd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A3780_04180
Peptidoglycan biosynthesis and degradation proteins [BR:krd01011]
 Precursor biosynthesis
  Amino acid ligase
   A3780_04180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST RimK PTS_2-RNA NHase_alpha GARS_A
Motif
Other DBs
NCBI-ProteinID: APG16795
LinkDB All DBs
Position
complement(911669..912769)
Genome map
AA seq 366 aa AA seqDB search
MAKLRVGVVFGGKSAEHEVSLQSAKNIVDAMDKSRFEVVLLGIDKQGQWHISDANNYLLN
ASDPARIALNPSQNSVALVPGNTAQQLIQAQNSAPLPDVDVIFPIVHGTLGEDGTLQGML
RLANLPFVGSDVLASAACMDKDVTKRLLRDAGLAVAPFITLTRSNRQQIAFSDVEAQLGL
PLFVKPANQGSSVGVSKVTSEAQYHEAVRLAFEFDKKVIVEKGIKGREIECAVLGNDDPQ
ASTCGEIVLHSEFYAYDTKYIDENGAQVVVPADIAPEINDKIRQIAVQAYQTLGCEGMAR
VDVFLTPDNEVVINEINTLPGFTNISMYPKLWQASGISYPDLITRLIELAIARHQVNSTL
KISVNG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactgcgggtaggggtcgtcttcggcggcaaatcagcggaacacgaggtgtcg
ttacagtcagcaaaaaatattgtcgatgccatggataagtcgcgctttgaggttgtgctg
ctggggattgataaacagggtcaatggcatatcagcgatgcgaataattacctgcttaac
gccagcgatccggcgcgtattgcgctgaatccgtcgcaaaacagcgtggcgctggtgccg
ggcaacaccgcgcagcagcttattcaggcgcaaaacagcgcgccgctaccggatgttgat
gtgattttccctatcgtccacggtacgttgggcgaagatggcaccttgcagggcatgctg
cgcctggcaaacctgccgtttgtcggctccgacgtgctcgcttcggcggcctgcatggat
aaagatgtcaccaagcgtttgctgcgtgatgccggattagctgtcgcgccatttatcacc
ctgacgcgctccaatcgtcagcagatcgcctttagcgacgtcgaagcgcagctcggcctg
ccgctgtttgtcaaaccggccaaccagggctcgtccgttggcgtcagcaaagtgaccagc
gaagcgcagtatcatgaagcggtgcgcctggcgtttgagttcgacaaaaaagtgatcgtt
gagaaaggcatcaaaggccgcgagatcgaatgcgcggtgctcggcaatgacgatccgcaa
gccagcacctgcggcgaaatcgtgctgcacagcgagttctacgcttacgacaccaaatac
attgatgaaaacggcgcgcaggtggtagtgcctgcggatattgcgccggagatcaacgac
aagatccgtcagattgcggtacaggcgtaccagacgcttggctgtgaagggatggcgcgc
gtcgatgtgttcctgacgccggacaacgaagtcgttatcaatgagatcaacacgctgccg
ggatttaccaacatcagcatgtatccaaaactgtggcaggcgagcggcatcagctatcct
gatctgatcacccgcctgattgagctggctattgcgcgccatcaggtaaacagcacgctg
aaaatttccgtcaacggttaa

DBGET integrated database retrieval system