KEGG   Kosakonia radicincitans: A3780_04200Help
Entry
A3780_04200       CDS       T04579                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
krd  Kosakonia radicincitans
Pathway
krd00730  Thiamine metabolism
krd00790  Folate biosynthesis
krd01100  Metabolic pathways
krd02020  Two-component system
Module
krd_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:krd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    A3780_04200
   00790 Folate biosynthesis
    A3780_04200
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    A3780_04200
Enzymes [BR:krd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     A3780_04200
Exosome [BR:krd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A3780_04200
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:krd00537]
 Enzymes
  A3780_04200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: APG16798
LinkDB All DBs
Position
915533..916963
Genome map
AA seq 476 aa AA seqDB search
MENIKVKQSALYLALLPVFFTSVIYAETTDTSVLEHRAAQGDISTPGGARRLTADQTAAL
RDSLIDKPAKNIILLIGDGMGDSEITAARNYAEGAGGYFKGIDALPLTGQYTHYALDKKT
GKPDYVTDSAASATAWSTGVKTYNGALGVDIHEKDHMTILEMAKAAGLATGNVSTAELQD
ATPAALVSHVISRRCYGPTVTSEKCALNALEKGGKGSITEQLLNTRADVTLGGGAKTFSE
TATAGEWQGKTLHEQAQARGYQMVSDASALAAISEANQDKPLLGLFADGNMPVRWEGPKA
SLHGNLDKPAVTCTPNAKRTDSVPTLAAMTEKAIDLLSKNEKGFFLQVEGASIDKQDHAA
NPCGQIGETVDLDEAVQKALEFAKKDGNTLVIVTADHAHASQIIPADTKAPGLSQALNTK
DGAVMAITYGNSEEESMEHTGTQVRIAAYGPHAGNVVGLTDQTDLFYTMKSALNLK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggagaatattaaagtgaaacagagcgcattatacctcgcattattacccgtgtttttt
acctctgttatttatgcagaaacaacggatacctccgttctcgaacatcgtgctgctcag
ggcgatatttccacgcctggcggcgcgcgtcgtctgactgccgatcaaaccgctgcacta
cgtgattcgctcatcgataagcccgccaaaaatattattttgttaattggtgatggcatg
ggcgattcagaaataaccgccgcacgaaattatgccgaaggcgctggtgggtatttcaaa
gggattgacgcattaccgttaaccggccagtacacgcactacgcgctggacaaaaaaacc
ggtaaaccggactacgtgacggattcagccgcctcggccactgcctggagcaccggcgtc
aaaacctacaacggcgcgctcggcgtcgatattcatgaaaaagatcatatgaccatcctc
gagatggcgaaagcggcggggctggcgaccggcaacgtctctaccgctgaattgcaggat
gccaccccggcagcgctggtttcgcatgtgatctcccgtcgctgctacggcccgacggtg
accagcgaaaaatgcgccctcaacgcgctggaaaagggcggtaaaggctcgatcaccgag
caattgctgaatacccgcgcggatgtgacgctgggcggcggcgcgaaaaccttcagcgaa
accgcgacggcgggcgagtggcaagggaaaacgctgcacgagcaggctcaggcccgtggt
taccagatggtgagcgatgcctctgcgctggcggccattagcgaagcgaaccaggataaa
ccgctgctcggcctcttcgccgatggcaatatgccggttcgctgggaagggccgaaagcg
tcgctgcacggcaatctcgacaaacccgccgtgacctgtacgccgaatgccaaacgtacc
gacagcgtaccgacgctggcggcaatgaccgaaaaggccattgatctgctgagcaaaaac
gagaagggcttcttcctgcaggtggaaggcgcgtctatcgataaacaggatcacgcggcg
aatccgtgcggtcagattggtgaaactgtcgatctggatgaagcggtacagaaggcgctg
gaatttgcgaaaaaagacggcaatacgctggtgattgtgactgccgatcatgcgcacgcc
agccagattattccggcggataccaaagcgccggggctgagccaggcgctgaataccaaa
gatggcgcagtgatggcgataacctacggcaactcggaagaggagtcgatggagcacacc
ggtacgcaagtccgcattgcggcttatggcccgcatgctggtaatgtcgtggggttaacc
gatcagaccgatctgttctacaccatgaaatcggcactgaacctgaagtaa

DBGET integrated database retrieval system