KEGG   Kosakonia radicincitans: A3780_04755
Entry
A3780_04755       CDS       T04579                                 

Gene name
lacZ
Definition
(GenBank) beta-D-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
krd  Kosakonia radicincitans
Pathway
krd00052  Galactose metabolism
krd00511  Other glycan degradation
krd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:krd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    A3780_04755 (lacZ)
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    A3780_04755 (lacZ)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    A3780_04755 (lacZ)
Enzymes [BR:krd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     A3780_04755 (lacZ)
SSDB
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N Bgal_small_N DUF4981 Glyco_hydro_2
Other DBs
NCBI-ProteinID: APG16904
LinkDB
Position
1035826..1038900
AA seq 1024 aa
MSVTALSSLVSRRDWENPAITHWHRLPAHAPLRSWRDENAARDDAASPARRLLNGEWRFS
LFGSPEAVPKRWITEDCTDAVAMPVPSNWQMQGFDTPIYTNVTYPIPVTPPFVPQQNPTG
CYSLTFAMEEGALAQGQTRIVFDGVNAAFYLWCNGQWIGYSQDSRLPAEFDLSKALKAGE
NRLAVMVLRWCDGSYLEDQDMWRMSGIFRDVSLQHKPQTHIADFHYVSELNADLTHAQLQ
VNVQLAGAFAACRVAVALWRGGEKIAAAQQSPGSAVVDERGAWAERLCVTLPVAAPALWS
AETPNLYRLTLTLLDAQGNVLEAEACDVGFRKVEIRHGLLLLNGKPLLIRGVNRHEHHPE
NGQAIDEATMRRDIELMKQHNFNAVRCSHYPNHPLWYRLCDRYGLYVVDEANIETHGMVP
MSRLADDPGWLPAMSERVTRMVQRDRNHPSIIIWSLGNESGHGANHDALYRWLKTTDPTR
PVQYEGGGANTAATDIVCPMYARVDQDQPFPAVPKWSIKKWIGLPGENRPLILCEYAHAM
GNSFGGFAKYWEAFRAFPRLQGGFVWDWVDQALTKTGDDGQPFWAYGGDFGDTPNDRQFC
MNGLVFPDRTPHPALYEAQRAQQFFQFSLLSTTPLVLEVESEYLFRATDNEYLRWSVARD
GDVLAQGEITLDIAPQGKQRIELNIPALEAAPGDVWLNVDVFQRAATHWSAADHRCAWDQ
WRLPAPLYITPRVVQNSRPTLQASEQEFVITHQSQRWHFCRRSGNLQQWWRDEQPTLLTP
LSDCFARAPLDNDIGISEVTRIDPNAWVERWKAAGMYALSAELLYCDVEERSTGIVVSTG
QRWLGAGKTAFISHKCWRIDGDGALHGDVTVQVARDIPPPARVGLVCQLAERHPQVSWLG
LGPHENYPDRQLAARQGRWTQPLSALHTPYIFPGENGLRCNTRALWFGAHQWQGDFHFSL
GCYSDEQLRETTHHHLLREEAGCWLHLDAFHMGVGGDDSWSPSVSPEFILRDETVRYAFC
WRQN
NT seq 3075 nt   +upstreamnt  +downstreamnt
atgtctgttaccgcattaagttcgctggtttcccgccgcgactgggaaaacccggcgatt
acccactggcaccgtttaccggctcatgcgcccctgcgtagctggcgtgatgaaaatgcg
gcgcgcgatgatgccgcttcacctgcgcggcgcctgctcaatggcgaatggcgcttcagc
ctgtttggctcgccggaagccgtaccgaaacgctggataacagaggattgcaccgatgcg
gtggcgatgccggtaccatcgaactggcagatgcagggatttgatacgcccatttatacc
aatgttacctatccgattccggtgacgcctccgtttgttccgcaacaaaacccgacgggt
tgttactcgctcacatttgcaatggaagaaggcgcgctggcgcaggggcagacgcggatt
gtttttgatggcgtcaatgcggcgttttatctttggtgtaacggccaatggatcggctat
tcgcaggacagccgcctgcccgccgagtttgacctcagtaaggcgctaaaagcgggggaa
aaccggctggcggtgatggtgctgcgctggtgcgatggcagctatctggaagaccaggat
atgtggcggatgagcgggatttttcgcgatgtctccctgcaacacaaaccgcagacgcat
attgccgatttccactatgtcagcgagctgaatgcggacctgacccacgcgcaattacag
gttaacgtgcaactggccggggcgtttgcagcgtgtcgcgttgccgttgccctgtggcgc
ggcggagaaaaaatcgccgccgcgcagcaatcgccgggcagcgccgtggtggatgagcgc
ggcgcgtgggcagaacgcctgtgcgtgacgctgccggttgccgcgcccgcgctgtggagc
gcggaaacaccgaacctctatcgcctgacattaaccctgctcgatgcacaaggaaacgta
ctggaagcggaagcctgcgacgtgggtttccgcaaagtggaaatccgtcatggtttgctg
ctgcttaacggcaaaccgctgttgattcgtggtgtaaaccgtcacgagcaccatccggaa
aacggacaggccattgatgaagccaccatgcggcgcgacattgagctgatgaaacagcac
aacttcaatgccgtgcgctgttctcactatccgaaccatccgctgtggtatcgcttgtgc
gatcggtacggcttatacgtcgtggatgaagccaatattgaaacccacggcatggtgccg
atgagccgcctggcggacgatccgggttggctgccagccatgagcgaacgtgtgacgcgc
atggtacagcgcgatcgcaaccatccgtcgatcattatctggtcgctgggcaacgaatct
ggtcatggcgcgaaccacgatgcgctgtatcgctggctgaaaacgaccgatccgacgcgt
ccggtgcagtatgaaggcggcggcgcgaacacggcggccaccgatattgtctgcccgatg
tatgcccgcgtcgaccaggatcagcctttcccggcggtgccgaagtggtcgattaaaaaa
tggatcggtttgcccggcgaaaatcgcccgctcattctttgcgaatacgcacatgcgatg
ggcaacagctttggcggttttgccaaatactgggaagcgttccgcgctttcccgcgtttg
cagggcggttttgtctgggactgggttgaccaggcattaaccaaaaccggtgatgatggg
caaccattctgggcttacggcggcgattttggcgatacgccgaatgaccgccagttctgt
atgaatgggctggtatttcccgatcgcacgccgcatccggcgctgtatgaagcgcagcgc
gcgcagcaatttttccagttcagcctgcttagcaccacgccgctggtgctggaagttgag
agcgaatatctgttccgcgccactgataatgaatacctgcgctggtctgtcgcccgcgat
ggagatgtactggcgcagggagaaatcacgctggatattgcgccgcaaggcaagcagcgt
attgagctgaacatacccgcgctggaggccgcgcccggtgatgtctggttgaatgtggat
gttttccagcgtgcggcgacgcactggtcggcggcggatcatcgctgcgcctgggatcag
tggcgtctgcccgcgccgttgtatatcactccgcgcgtagtgcagaactcgcgcccgaca
ttgcaggccagcgagcaggaatttgtcatcacgcatcagtcgcagcgctggcacttctgt
cgccgcagcggcaacctgcaacagtggtggcgcgatgaacagccgacgctgctgactccg
ctgagcgactgttttgcccgtgcgccgctggataacgacattggtatcagcgaggtgaca
cgcatcgatcccaacgcgtgggtggaacgctggaaagcggcaggcatgtacgctctgtcg
gctgaactgctttattgtgacgtcgaagagcgcagcaccgggattgtggtgagtaccggt
cagcgctggctgggtgcagggaaaaccgcgtttatcagccataaatgctggcgaattgat
ggtgacggcgcactgcatggcgatgtcacggtacaggtggcgcgagatattccgccgcct
gcacgggtggggctggtctgccaactggcggagcggcatccgcaggtcagctggctgggg
ctggggccgcatgaaaactacccggatcgccagctggcggcgcgtcagggacggtggacg
cagccgctgtcggcgctgcacacgccctatattttccccggcgaaaatgggctgcgctgc
aacacgcgcgcattgtggttcggtgcgcaccagtggcagggggatttccatttttccctc
ggctgctacagcgatgagcaactgcgggaaaccacgcaccatcacttattgcgcgaagaa
gccggttgctggctgcatctcgatgccttccacatgggcgttggcggcgatgactcctgg
agcccgagcgtgtcgccggagtttatcctgcgagatgagacggtgcgttacgccttttgc
tggcggcagaactaa

DBGET integrated database retrieval system