KEGG   Kosakonia radicincitans: A3780_06255Help
Entry
A3780_06255       CDS       T04579                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
krd  Kosakonia radicincitans
Brite
KEGG Orthology (KO) [BR:krd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A3780_06255
Enzymes [BR:krd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A3780_06255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_8 Thi4 FAD_binding_3 Glutaredoxin K_oxygenase FMO-like DAO AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: APG17178
LinkDB All DBs
Position
1368034..1369599
Genome map
AA seq 521 aa AA seqDB search
MLDTTMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLGEIAELSDKVSFKEDNSLAV
RKPSFLITNPGLTSGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDLDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVFVNGKE
FGQGRMTLTEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVADYDVDVIDSQSAKKLTPAAVEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVTGLEYRDRISGDVHQVALAGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccacaatgaaaacccagctcaaggcctaccttgagaaactgactaaacct
gttgagttgattgctacgctggatgacagcgcgaaatcggcagaaatcaaagaactgctg
ggcgaaatcgctgagctgtctgacaaagtctcctttaaagaagacaacagcctggcggtg
cgcaaaccgtcattcctgatcaccaacccaggcttaaccagcggcccgcgctttgccggt
tcgccgttgggtcacgaatttacctcactggtgctggcactgctgtggaccggtgggcat
ccgtcgaaagaggcgcaggcgctgctggagcagatccgcgatctcgacggtgactttgaa
tttgaaacctattactcgctctcctgccataactgcccggacgtagtgcaggcgctgaac
ctgatggccgtgctgaacccgcgcatcaaacatacggcgattgacggcggtacgttccag
aacgaaatcaccgatcgcaacgtaatgggcgttccggcggtgttcgtgaacggtaaagag
ttcggccaggggcgtatgacgctgacggaaatcgtcgccaaaatcgataccggcgcggaa
aaacgtgcggccgaagagctgaacaaacgcgacgcttacgatgtattgatcgtcggttcc
ggcccggcgggcgcggcggcggcagtctactctgcgcgtaaaggtattcgtaccggcctg
atgggcgagcgtttcggcggccaggtgctggataccgtggatatcgaaaactacatctcc
gtaccgaaaaccgaaggccagaaactggcgggtgcactgaaagcgcacgtagcggattac
gacgtggatgtgattgacagccagagcgccaaaaaactgaccccggcggcagttgaaggc
ggtctgcaccagattgaaaccgcgtccggcgcggtgctgaaagctcgcagcatcatcatt
gcgaccggcgcgaaatggcgcaacatgaacgttccgggtgaagatcagtatcgcaccaaa
ggcgtaacctactgcccgcactgcgacggcccgctgtttaaaggcaaacgtgtggcggtg
atcggcggcggtaactctggcgtggaagcggctatcgacctggcggggattgttgagcac
gtgacgctgctggaattcgccccggaaatgaaagccgaccaggtattgcaggataaagtg
cgcagcctgaaaaacgtcgacatcattctgaacgcgcagaccaccgaagtgaaaggcgac
ggcagcaaagtgaccggccttgagtaccgtgaccgcatcagcggtgacgtacatcaggtc
gcgctggccgggattttcgtgcagattggtctgctgccgaacaccacctggctggaaggc
gcgattgagcgcaaccgcatgggcgaaatcatcattgatgccaaatgtgaaaccagcgtg
aaaggcgtgtttgctgcaggcgactgcaccacggtgccgtacaaacagatcatcattgca
accggtgaaggcgctaaagcctctctgagttcgtttgactacctgattcgcactaaaact
gcataa

DBGET integrated database retrieval system