KEGG   Kosakonia radicincitans: A3780_06575
Entry
A3780_06575       CDS       T04579                                 

Definition
(GenBank) phosphoglucomutase, alpha-D-glucose phosphate-specific
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
krd  Kosakonia radicincitans
Pathway
krd00010  Glycolysis / Gluconeogenesis
krd00030  Pentose phosphate pathway
krd00052  Galactose metabolism
krd00230  Purine metabolism
krd00500  Starch and sucrose metabolism
krd00520  Amino sugar and nucleotide sugar metabolism
krd00521  Streptomycin biosynthesis
krd01100  Metabolic pathways
krd01110  Biosynthesis of secondary metabolites
krd01120  Microbial metabolism in diverse environments
Module
krd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
krd_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:krd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A3780_06575
   00030 Pentose phosphate pathway
    A3780_06575
   00052 Galactose metabolism
    A3780_06575
   00500 Starch and sucrose metabolism
    A3780_06575
   00520 Amino sugar and nucleotide sugar metabolism
    A3780_06575
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A3780_06575
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    A3780_06575
Enzymes [BR:krd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     A3780_06575
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Other DBs
NCBI-ProteinID: APG17233
UniProt: A0A1T5HRC9
LinkDB
Position
1431074..1432714
AA seq 546 aa
MANHPRAGQPAQQSDLINVAQLTAQYYVLKPEVGNSEHAVKFGTSGHRGSAHRHSFNEPH
ILAIAQAIAEERAKNGITGPCYVGKDTHALSEPAFISVLEVLTANGVDVIVQENNGFTPT
PAISNAILVHNKNGGAQADGIVITPSHNPPEDGGIKYNPPNGGPADTNVTKVVEDRANAL
LADGLKGVKRLTLDAALASGHVTEKDLVQPFIEGLADIVDMAAIQKAGLKLGVDPLGGSG
IEYWKRIAEYYKLDLSIVNDQVDQTFRFMHLDKDGAIRMDCSSECAMAGLLALRDKFDLA
FANDPDYDRHGIVTPAGLMNPNHYLAVAINYLFQHRPQWGKDVAVGKTLVSSAMIDRVVN
DLGRKLVEVPVGFKWFVDGLHDGSFGFGGEESAGASFLRFDGTPWSTDKDGIIMCLLAAE
ITAVTGKNPQQHYDELAARFGAPSYNRLQASASSAQKAALSKLSPEMVSASTLAGDPITA
RLTAAPGNGASIGGLKVMTDNGWFAARPSGTEDAYKIYCESFLGDEHRKLIEKEAVEIVS
EVLKNA
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggctaaccacccgcgtgcgggtcaacctgcacaacagagcgatttgattaacgtcgcc
cagcttactgcgcagtactatgtgttgaaacctgaagtcggtaattcagaacatgcggtg
aaatttggcacttccggccaccgtggcagcgcccatcgccacagcttcaacgagccacac
attctggccatcgctcaggcgattgccgaagagcgtgcaaaaaacgggattaccgggccg
tgctatgtgggtaaagatactcacgcgctgtctgaaccggcgtttatctccgtgctggaa
gtgctgacagcaaacggtgtggatgtgatcgtgcaggaaaataacggcttcacgcccacg
cctgccatctcaaatgccattctggtacacaacaaaaacggcggcgcgcaggcggacggt
atcgttatcaccccgtcgcataacccaccagaagatggcgggatcaagtacaacccgcct
aacggtggcccggctgataccaacgttaccaaagtggtggaagaccgcgcgaatgcgctg
ttggcggatggtctgaaaggcgtgaaacgtcttacgctggatgcagcgctggcctccggt
catgtgacagaaaaagatctggtgcagccatttattgaagggctggcggacattgtcgac
atggcggcaatccagaaagctggcctgaaactgggcgttgatccgctgggcggctccggt
attgaatactggaagcgtatcgcggagtactacaagctggatctgagcatcgttaacgat
caggtcgatcagaccttccgctttatgcacctggataaagacggcgcgatccgtatggat
tgctcctccgaatgtgcgatggcgggtctgttggcgctgcgcgacaagttcgatttggcg
tttgctaacgatccggactacgaccgtcacggcatcgtaaccccggcagggttgatgaac
ccgaaccactacctggcggttgctatcaactacctgttccagcaccgtccgcagtggggc
aaagatgttgccgtcggcaaaacgctggtctcttcagcgatgatcgaccgcgtggttaac
gaccttggccgtaagctggtggaagtgccggtgggtttcaaatggtttgttgatggtctg
catgacggcagtttcggctttggtggtgaagagagcgcgggcgcgtccttcctgcgtttc
gacggtacgccgtggtcaacagataaagacggcatcatcatgtgtctgctggcggctgag
atcaccgccgtgaccgggaaaaacccgcagcagcattacgatgagctggcggcacgcttc
ggcgcgccgagctacaaccgtttgcaggcttctgcctcttccgcgcagaaagccgcgctg
tccaaactctctccggaaatggtgagcgccagcacgctggcaggcgaccctatcactgcg
cgtctgacggctgctccgggcaatggcgcatcgattggcggcctgaaagtgatgaccgac
aacggctggttcgccgcgcgtccgtcaggtactgaagacgcctacaaaatctactgcgaa
agtttcctcggtgacgaacaccggaagctgattgaaaaagaagcggtagaaattgtcagc
gaagtgctgaaaaacgcgtaa

DBGET integrated database retrieval system