KEGG   Kosakonia radicincitans: A3780_06665Help
Entry
A3780_06665       CDS       T04579                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
krd  Kosakonia radicincitans
Pathway
krd00020  Citrate cycle (TCA cycle)
krd00190  Oxidative phosphorylation
krd00650  Butanoate metabolism
krd01100  Metabolic pathways
krd01110  Biosynthesis of secondary metabolites
krd01120  Microbial metabolism in diverse environments
krd01130  Biosynthesis of antibiotics
krd01200  Carbon metabolism
Module
krd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
krd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
krd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:krd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A3780_06665 (sdhA)
   00650 Butanoate metabolism
    A3780_06665 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A3780_06665 (sdhA)
Enzymes [BR:krd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A3780_06665 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     A3780_06665 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: APG17250
LinkDB All DBs
Position
1449784..1451550
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMALRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEKGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQ
ESIAEQGALRDASESDIEGALTRLNRWNNNRSGEDPVTIRKALQECMQHNFSVFREGDAM
AKGLEQLKVIRERLKEARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAH
SRFDYPDRDDENWLCHSLYLPETESMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgccagtcagagaatttgatgctgttgttattggcgcgggcggcgcaggtatg
cgcgcggcgctgcaaatttcccagagcgggcaaacctgtgcgctgctctccaaagttttc
ccaacccgttcccacactgtgtctgcgcagggcggtatcaccgtagccctgggcaatacc
catgaagataactgggaatggcacatgtatgacacggtaaaaggttccgactacatcggt
gaccaggacgcgattgaatatatgtgcaaaaccggcccggaagcgattcttgagctggag
catatgggcctgccgttctcccgtcttgatgatggccgtatctatcagcgtccgtttggc
ggccagtcgaagaacttcggcggcgagcaggcggcgcgtaccgcagcggcagcggaccgt
accggccatgcgctgctgcataccctttatcagcagaacctgaaaaatcacaccaccatc
ttttccgagtggtacgcgctggatctggtgaaaaaccaggatggcgctgtcgtgggctgt
accgcactgtgcatcgaaaccggtgaagtcgtctacttcaaagcccgcgcaaccgtgctg
gcaactggcggcgcaggccgtatttaccagtccaccaccaatgcgcacattaataccggc
gacggcgtgggtatggcgctgcgcgcgggtgtaccggtgcaggatatggagatgtggcag
ttccacccgaccggtatcgccggggcaggggtgctggtaacggaaggctgccgtggtgaa
ggcggctatctgcttaacaaacacggcgagcgctttatggagcgttatgcgccgaacgcc
aaagacctggcgggccgtgatgtggtggcgcgttccatcatgatcgaaatccgtgaaggt
cgcggttgcgacggtccatggggaccgcacgccaaactgaaactcgatcatctgggtaaa
gaagtactcgaatcgcgtctgccggggatcctggaactgtcgcgcaccttcgcacatgtg
gatccggtgaaagagccaattccggtgatcccgacctgccactatatgatgggcggtatt
ccgaccaaagtgaccggccaggcgctgacggtcaacgagaagggcgaagatgtcgtgatc
ccggggctgtttgcggtgggcgaaatcgcctgcgtatcggttcacggcgccaaccgcctg
ggcggtaactcgctgctcgacctggtggtctttggccgtgcagcaggtctgcatttacaa
gaatctatcgctgaacagggcgcgctgcgcgatgccagcgaatcggatatcgaaggggcg
ctcacccgcctcaaccgctggaataacaatcgtagcggcgaagatccggtcaccatccgc
aaagcgctgcaagagtgtatgcagcataacttctcggtgttccgcgaaggtgatgcgatg
gcgaaaggtcttgaacaactgaaagtgatccgcgagcgcctgaaagaggctcgtctggat
gatacgtcgagcgagttcaatacccagcgcgttgagtgcctggagctggataacctgatg
gaaaccgcttacgcaacggctgtttccgcaaacttccgtaccgaaagccgtggcgcgcac
agccgcttcgactatccggatcgtgacgatgagaactggttgtgccacagcctgtatctg
ccagaaacggaatccatgacgcgccgtagcgtgaatatggaaccgaaactgcgtccggcg
ttcccgccgaagattcgtacttattaa

DBGET integrated database retrieval system