KEGG   Kosakonia radicincitans: A3780_06670Help
Entry
A3780_06670       CDS       T04579                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
krd  Kosakonia radicincitans
Pathway
krd00020  Citrate cycle (TCA cycle)
krd00190  Oxidative phosphorylation
krd00650  Butanoate metabolism
krd01100  Metabolic pathways
krd01110  Biosynthesis of secondary metabolites
krd01120  Microbial metabolism in diverse environments
krd01130  Biosynthesis of antibiotics
krd01200  Carbon metabolism
Module
krd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
krd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
krd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:krd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A3780_06670 (sdhB)
   00650 Butanoate metabolism
    A3780_06670 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A3780_06670 (sdhB)
Enzymes [BR:krd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A3780_06670 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     A3780_06670 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: APG20966
LinkDB All DBs
Position
1451566..1452282
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDDAPRMQDYTLEAEEGRDMMLLDALIQLKEKDSTLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALGNGKQKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQAPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETDSRLEGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgaattctcgatttatcgctataacccggatgtggatgacgcgccgcgtatg
caggattacacgctggaagcggaagaagggcgtgacatgatgttgctggatgcattaatc
cagctgaaagaaaaggattctacactgtcgttccgccgctcctgccgtgaaggtgtatgt
ggttccgatggtctgaacatgaacggtaagaatggtcttgcctgtatcaccccgatttcc
gcgcttggcaacggcaaacagaagatcgttatccgcccgctgccagggttgccggttatc
cgcgatttggtggtggacatgggacaattctatgcccaatatgagaagattaaaccttac
ttattgaataatgggcaaaatccaccggccagagaacatttacaggcaccagagcagcgt
gaaaagcttgacggtctgtacgaatgtattctttgcgcctgctgttctacgtcctgcccg
tcattctggtggaacccggataagtttatcggcccggctggcttgctggcggcgtatcgc
ttcctgatcgacagccgcgataccgaaaccgacagccgtctggaagggttgagcgatgct
ttcagcgtattccgctgccacagcatcatgaactgcgtcagtgtatgtccgaaagggctg
aacccgacgcgcgccatcggccatattaagtcgatgttgttgcaaagaagtgcgtaa

DBGET integrated database retrieval system