KEGG   Kosakonia radicincitans: A3780_06815
Entry
A3780_06815       CDS       T04579                                 

Gene name
galM
Definition
(GenBank) galactose-1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
krd  Kosakonia radicincitans
Pathway
krd00010  Glycolysis / Gluconeogenesis
krd00052  Galactose metabolism
krd01100  Metabolic pathways
krd01110  Biosynthesis of secondary metabolites
krd01120  Microbial metabolism in diverse environments
Module
krd_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:krd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A3780_06815 (galM)
   00052 Galactose metabolism
    A3780_06815 (galM)
Enzymes [BR:krd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     A3780_06815 (galM)
SSDB
Motif
Pfam: Aldose_epim
Other DBs
NCBI-ProteinID: APG17273
LinkDB
Position
complement(1477191..1478231)
AA seq 346 aa
MLNESATAAPDGLPFRLITLRNSAGMVVTLMDWGATLLSARVPLKDGSVREALLGCASPE
YYLQQSAFLGASVGRYANRISKSRFQLDGQTYALTPSQGENQLHGGPEGFDKRRWRIERQ
NENEVLFSLTSPDGDQGFPGNVNATAHFRLGEDNRLAIEYRATTDKPCPVNLTNHAYFNL
DGYQSDVRSHSLQLLADEYLPVDEMGLPTGGLKKVALTSFDFRTPKTVAEEFLSDDDQRA
VKGYDHAFLLQAKGDASLPAAQLWSADNQLQMTVYTSAPALQFYSGNYLDGTPARGGKTY
AAWQGLALESEFLPDSPNRPDYPQPDCVLRPGSEYVSLTEYHFIAL
NT seq 1041 nt   +upstreamnt  +downstreamnt
gtgctaaacgaatctgcgacggcggctccggacgggctgccctttcgtctcatcactctg
cgcaacagcgccggaatggtggtgacactgatggactggggcgcgacgctgctttcggct
cgcgtgccactgaaagatggctccgtgcgtgaagcgctgctcggctgcgcgtcaccggaa
tactatctgcaacaatccgcgtttctcggcgcttcggtgggccgttacgccaaccgtatc
agcaagagccgttttcagcttgatggtcagacatatgcgcttacgcccagccagggcgaa
aatcagttgcatggcggcccggaaggtttcgacaagcgtcgctggcggattgagcgtcag
aatgaaaacgaagtgctgttttcgctcacttcgccggatggcgatcagggttttccgggc
aacgtaaacgccacggcgcattttcgcctcggcgaggataaccgtctggcaattgaatat
cgtgccacgacggataaaccctgcccggtcaacctgaccaaccacgcctatttcaacctc
gatgggtaccagtctgatgtgcgtagccactccctgcaactgctggcagatgaatatctg
cctgtggatgagatggggctgccgaccggtgggttgaaaaaagtcgcgctgaccagtttt
gatttccgtacgcccaaaaccgtggcggaagagtttctcagcgatgacgatcagcgtgcg
gtaaaaggctacgatcatgcgtttttgttgcaggcgaagggcgatgccagcctgcctgcg
gcacagttgtggtcggcggataatcaactgcaaatgacggtttataccagcgctcctgcg
ctccagttctattccggcaattatctcgacggtacgccagcgcgcggggggaaaacctac
gctgcatggcaaggcctggcgctggagagcgaatttttgcccgacagcccgaatcgcccg
gactatccgcagccggactgtgttttacgccccggcagcgaatatgtcagcctgacggaa
tatcactttattgcgctttaa

DBGET integrated database retrieval system