KEGG   Kosakonia radicincitans: A3780_06820
Entry
A3780_06820       CDS       T04579                                 

Definition
(GenBank) galactokinase
  KO
K00849  galactokinase [EC:2.7.1.6]
Organism
krd  Kosakonia radicincitans
Pathway
krd00052  Galactose metabolism
krd00520  Amino sugar and nucleotide sugar metabolism
krd01100  Metabolic pathways
Module
krd_M00554  Nucleotide sugar biosynthesis, galactose => UDP-galactose
krd_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:krd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    A3780_06820
   00520 Amino sugar and nucleotide sugar metabolism
    A3780_06820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:krd04147]
    A3780_06820
Enzymes [BR:krd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.6  galactokinase
     A3780_06820
Exosome [BR:krd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A3780_06820
SSDB
Motif
Pfam: GalKase_gal_bdg GHMP_kinases_N GHMP_kinases_C
Other DBs
NCBI-ProteinID: APG17274
LinkDB
Position
complement(1478225..1479373)
AA seq 382 aa
MSLKEKTQSLFAEKFGYPATHTIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRT
DRIVRVIAADYDNQTDEFSLDAPIVTHDSQQWSNYVRGVVKHLQKRNAGFGGADLVISGN
VPQGAGLSSSASLEVAVGTVFQQLYHLPLDGAQIALNGQEAENQFVGCNCGIMDQLISAL
GKKGSALLIDCRSLGTKAVSMPEGVAIVIINSNFKRTLVGSEYNTRRQQCETGARFFQQK
ALRDVSIDQFNAVAHELDPLVSKRVRHVLTENARTVEAAAALEKGDLQRMGVLMAESHAS
MRDDFEITVPQIDTLVEIVKATIGDKGGVRMTGGGFGGCVVALVPEALVPAVKQAVESQY
EAKTGIKETFYVCKPSQGAGQC
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgagtctgaaagagaaaacacaatccctgtttgctgagaaatttggctaccctgccacc
cataccattcaggctccgggccgcgtgaatctgattggtgaacatactgactataacgac
ggttttgtactgccctgcgccattgattaccagacggtgattagctgcgcgccgcgcacc
gatcgcatcgtgcgggtgattgccgccgattatgataaccagacggatgaattttccctc
gacgccccgattgtgactcacgacagccagcagtggtccaactatgtgcgtggcgtagtg
aaacacctgcaaaaacgcaacgcaggctttggcggcgccgatctggtgatcagcggcaac
gtaccgcaaggcgcggggttaagctcctcagcatcgctggaagtggcggtcggcaccgtc
ttccagcaactttaccatctgccactggatggcgcacagattgcccttaacggccaggaa
gcggagaaccagttcgtcggctgtaactgcggcattatggatcagttgatctcggcgctg
ggcaaaaaaggcagcgcgttgctgatcgactgccgctcgctcggcaccaaagcggtgtcg
atgccggaaggcgtggcaattgtcatcattaacagtaacttcaaacgcacgctggtcggc
agtgaatacaacacgcgacgtcagcagtgcgaaaccggcgcgcgtttcttccagcagaaa
gcgctgcgtgatgtcagcatcgatcagttcaatgcggtagcgcatgagttggatccgctg
gtcagcaaacgcgtacgccatgtgctgacagaaaacgcgcgcacggtcgaagcggccgcc
gcgctggagaaaggcgatctgcaacgcatgggcgtgctgatggctgaatcccacgcgtca
atgcgcgatgattttgaaatcaccgtgccgcaaatcgatacgctggtcgagattgtgaaa
gccaccatcggtgataaaggcggcgtgcgcatgaccggtggtggcttcggcggctgcgtt
gtcgcgctggtgccggaagcgctggttcctgcggtcaaacaggccgtggaaagccagtac
gaagccaaaaccggcatcaaagaaaccttctatgtgtgcaaaccttcacagggagcagga
cagtgctaa

DBGET integrated database retrieval system