KEGG   Kosakonia radicincitans: A3780_06825
Entry
A3780_06825       CDS       T04579                                 

Definition
(GenBank) galactose-1-phosphate uridylyltransferase
  KO
K00965  UDPglucose--hexose-1-phosphate uridylyltransferase [EC:2.7.7.12]
Organism
krd  Kosakonia radicincitans
Pathway
krd00052  Galactose metabolism
krd00520  Amino sugar and nucleotide sugar metabolism
krd01100  Metabolic pathways
Module
krd_M00554  Nucleotide sugar biosynthesis, galactose => UDP-galactose
krd_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:krd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    A3780_06825
   00520 Amino sugar and nucleotide sugar metabolism
    A3780_06825
Enzymes [BR:krd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.12  UDP-glucose---hexose-1-phosphate uridylyltransferase
     A3780_06825
SSDB
Motif
Pfam: GalP_UDP_tr_C GalP_UDP_transf HIT
Other DBs
NCBI-ProteinID: APG17275
LinkDB
Position
complement(1479376..1480422)
AA seq 348 aa
MTQFNPVDHPHRRYNPLTDQWILVSPHRAKRPWQGAQETPAKQTLPAHDPDCFLCPGNTR
VTGDKNPDYTSTYVFTNDFAALMTDTPQAPESSDPLMRSQSARGTSRVICFSPDHSKTLP
ELSLNALEEVIKTWQQQTAELGQHYPWVQVFENKGAAMGCSNPHPHGQVWANSFLPNEVE
REDRLQKAYFAEHHSPMLVDYVQRELNDGSRTVVETDHWLAVVPYWAAWPFETLLLPKAH
IQRITDLTAAQRSDLALALKKLTSRYDNLFQCSFPYSMGWHGAPFNGEENDHWQLHAHFY
PPLLRSATVRKFMVGYEMLAETQRDLTAEQAAERLRALSDVHFRESGE
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgacgcaatttaacccggtcgatcacccgcatcgccgctacaacccgctgaccgatcag
tggatcctggtttctccgcatcgcgcaaagcgtccctggcaaggggcgcaagaaacgcct
gcgaagcaaacattgcctgcacacgatccggattgcttcctgtgtccgggtaatactcgc
gtaacgggcgataaaaacccggattacaccagtacttacgtgttcaccaatgattttgcg
gcgctgatgaccgacacgccgcaggcgccggaaagcagcgatccgctgatgcgcagccag
agcgcgcgcgggaccagccgggttatttgcttctcgccggatcacagcaaaacgctgccg
gaactgagcctgaacgcgctggaagaggtaataaaaacctggcaacagcaaaccgccgag
ctgggccagcactatccatgggtgcaggtgtttgagaacaaaggcgcggcaatgggctgc
tccaatccgcatccgcatggccaggtgtgggcgaatagctttctgcccaacgaagtggaa
cgcgaagaccgcctgcaaaaagcgtactttgctgaacatcactcaccgatgctggtcgat
tatgtgcagcgcgagctgaatgacggcagccgtacggtggtagaaacggaccactggctg
gccgtggtgccttactgggcggcctggccattcgaaacgctgctgttgccgaaggcgcat
atccagcgcattaccgacttaaccgcagcacagcgcagcgatctggcgctggcgctgaaa
aaattgaccagccgttacgacaatctgttccagtgctctttcccctactcgatgggctgg
cacggcgcgccgtttaacggtgaagagaatgatcactggcagttacacgcgcatttctat
ccgccgctgctgcgttccgctaccgtgcgtaaatttatggtgggctacgaaatgctggcg
gaaacccagcgcgatctgacggcagaacaagccgctgaacgcctgcgtgcgctgagcgat
gtccattttcgcgaatccggagaataa

DBGET integrated database retrieval system