KEGG   Kosakonia radicincitans: A3780_06830
Entry
A3780_06830       CDS       T04579                                 

Definition
(GenBank) UDP-glucose 4-epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
krd  Kosakonia radicincitans
Pathway
krd00052  Galactose metabolism
krd00520  Amino sugar and nucleotide sugar metabolism
krd00541  O-Antigen nucleotide sugar biosynthesis
krd01100  Metabolic pathways
Module
krd_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:krd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    A3780_06830
   00520 Amino sugar and nucleotide sugar metabolism
    A3780_06830
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    A3780_06830
Enzymes [BR:krd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     A3780_06830
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind NAD_binding_10 NmrA adh_short KR NAD_binding_4 UDPG_MGDP_dh_N TrkA_N adh_short_C2 Semialdhyde_dh
Other DBs
NCBI-ProteinID: APG17276
LinkDB
Position
complement(1480433..1481449)
AA seq 338 aa
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLNEIERFGGKSALFVEGDVR
DEALLAEILHDHAIEAVIHFAGLKAVGESVAKPLEYYDNNVNGTLRLIDAMRAANVKNLI
FSSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPEWSIALLRYFNP
VGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGSDYPTPDGTGVRDYIHVMDLA
DGHVAAMQQLAGKPGVHIYNLGAGVGSSVLDVVNAFSKACGKPVAWHFAPRREGDLPAYW
ADATKADKELNWRVTRTLDEMAEDTWRWQSRHPQGYPD
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgcgagttctggttactggtggtagcggttacataggaagccacacctgcgtgcaactg
ctgcaaaacggccatgacgtcatcattctggataacctctgtaacagtaagcgcagcgtg
ctcaatgaaatcgagcgcttcggcggaaaatccgcgctgttcgttgaaggcgatgttcgc
gatgaagcgctgctggcggaaatcctgcacgatcatgccattgaagcggtcattcacttt
gccgggctgaaggccgttggcgaatccgtggcgaagccgctggagtactacgacaacaac
gtcaacggtacgctgcgcctgatcgacgccatgcgcgcggccaacgtcaaaaacctgatt
ttcagctcctccgccacggtctacggcgatcaaccgaaaatcccttatgtcgaaagcttc
cctaccggaacgccgcaaagtccgtacggcaaaagcaagttgatggtggaacagatcctc
accgacctgcaaaaagcccagccggagtggagcatcgcgctgctgcgctacttcaacccg
gttggcgcgcatccgtcaggagatatgggcgaagatccgcagggtatcccgaataacctg
atgccttacatcgcgcaggttgccgttggccgtcgcgattctctggcgatcttcggtagc
gattatccgacgccggatggcacgggcgtgcgtgattacattcatgtgatggacctggct
gacggtcacgttgcggctatgcaacaactggccggcaaaccgggcgtccatatttacaac
ctcggcgccggcgtcggcagcagcgtactggatgtggtcaacgcgttcagcaaagcctgc
ggcaaaccggtggcatggcactttgcgccgcgccgcgagggcgatttaccggcctactgg
gccgacgcgaccaaagccgataaagagctgaactggcgcgtaacccgtacgcttgacgaa
atggcagaagatacctggcgctggcagtcacgccatccgcagggttatccggattga

DBGET integrated database retrieval system