KEGG   Kosakonia radicincitans: A3780_15285Help
Entry
A3780_15285       CDS       T04579                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
krd  Kosakonia radicincitans
Pathway
krd00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:krd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    A3780_15285
Enzymes [BR:krd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     A3780_15285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Cellulase DUF4434 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: APG18859
LinkDB All DBs
Position
complement(3342120..3344177)
Genome map
AA seq 685 aa AA seqDB search
MNKFAPLSPKVVSLLHGADYNPEQWENYPGIIDDDIAMMKQANCNVMSIGIFSWSKLEPR
EGEFNFAWLDSVIEKLYAAGIHIFLATPSGARPAWMSQKYPQVLRVGRDRVPALHGGRHN
HCMTSPIYREKTLKINTLLAERYAQHPAVLGWHISNEYGGECHCDLCQQKFRDWLQARYQ
TLENLNHAWWSDFWSHTYSDWSQIQSPSPQGEVSIHGLNLDWRRFNTAQVTDFCRHEIAP
LKAANAQLPVTTNFMEYFYDYDYWQLAPALDFISWDSYPMWHRDKDETQLACYTAMYHDM
MRTLKGGKPFVLMESTPSVTNWQPTSKVKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAVIDHVGHLDTRVGREVCALGEMLAKLTPVMGCRTEARVAIIFDQQNRWALDDA
EGPRNKGMEYEKTVNEHYRPFWEKGIAVDVINADADLSCYQLVIAPMLYMVREGFAERAE
AFVAAGGHLVTSYWTGVVNESDLCYLGGFPGPLRKLVGIWAEEIDCLDDNERNLVQGLAG
NEAGLQGPYQARHLCELIHAESAKPLATYRDDFYAGRPAVTVNQFGKGKAWHVASRNDLA
FQRDFFASIIDELALPRAVEQDFPPGVVATARTDGETTFVFIQNFSAQQQTITLPPGYQD
CLSAATVSGSLVLTPWDCRVVSRQA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttgcgcctttaagcccgaaggttgtctcgctattgcatggcgcggactat
aacccggaacaatgggagaattatcccggtattattgatgacgatattgccatgatgaag
caggcaaattgcaatgtcatgtcgatcgggatatttagctggtcgaaactggagccgcgg
gaaggtgagtttaatttcgcctggctcgattcggtgattgaaaaattatatgcagcggga
attcatattttcctcgctacgccgagcggcgcacggcccgcctggatgtcgcagaaatat
ccgcaagtgctgcgcgtcgggcgcgatcgcgtgccggcgctgcacggcgggcggcacaat
cactgcatgacatcgccgatctaccgggaaaaaacgctgaaaatcaatacgctgctggct
gaacgttatgcgcagcatccggcggtactcggctggcatatttccaacgagtacggcgga
gaatgccactgcgatttgtgtcagcaaaaattccgcgactggctgcaagcccgttaccag
acgctggaaaacctcaaccacgcctggtggagcgatttctggagccacacttacagcgac
tggtcgcaaattcagtcgccgtcgccgcagggcgaagtgtcgatccacggtctgaatctc
gactggcggcgctttaataccgcgcaggtcaccgatttctgccgccatgaaatcgcgcca
ttgaaagccgcgaatgcacagcttccggtgaccaccaactttatggagtatttctacgat
tacgactactggcaactcgcgccagcgctcgactttatctcctgggacagctatccgatg
tggcaccgggacaaagacgaaacgcagctcgcctgctacaccgcgatgtatcacgacatg
atgcgcacgttgaaaggcggcaagccgtttgtgctgatggaatccacgccgagcgtcact
aactggcagccgaccagcaaagtgaaaaagccgggaatgcatattctgtcgtcattacag
gcggtggcgcacggcgcggattcggtgcagtacttccagtggcggaaaagtcgcggctcg
gttgagaagttccatggcgcggtaatcgaccatgttggccacctggatacccgcgtcggg
cgcgaagtgtgtgcgctgggcgagatgctggcaaaactcacgccggtaatgggctgtcgc
accgaggcgcgcgtggcgatcattttcgaccagcaaaaccgctgggcgctggatgatgcc
gaaggcccgcgcaataagggaatggagtacgaaaaaacggttaatgagcactaccgcccg
ttctgggaaaagggcatcgcggtggatgtcattaacgccgacgcggatctgagctgttat
caactggtgatcgcgcccatgctctatatggtgcgcgagggctttgccgaacgcgccgaa
gcgtttgtcgcggcgggcgggcatctggtcacctcttactggaccggtgtggtgaacgaa
agcgatctctgctatctcggcggcttccctggtccgctacgcaaactggtgggtatctgg
gcggaggagatcgactgcctggatgacaatgaacgcaatctggtgcaggggctggcgggc
aacgaggccgggttacaggggccgtatcaggcgcgtcatttgtgcgaactgatccatgcc
gagagcgccaaaccactggccacttaccgggatgatttctacgccgggcgcccggcggta
acggtcaatcagttcggcaaaggtaaggcgtggcacgtcgcttcgcgcaacgatctggcc
ttccagcgcgatttctttgccagcattattgacgaactggcgctgccgcgcgccgttgag
caggatttcccgccgggcgtggtggctaccgcgcgtaccgacggcgaaaccacatttgtc
tttatccagaacttcagcgctcagcaacagacgattacgctgccgccaggctaccaggat
tgtctgtcggccgcgaccgtcagcggctcgctggtgctgacaccgtgggattgtcgcgtt
gttagccgccaggcataa

DBGET integrated database retrieval system