KEGG   Kosakonia radicincitans: A3780_16350
Entry
A3780_16350       CDS       T04579                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
krd  Kosakonia radicincitans
Pathway
krd00010  Glycolysis / Gluconeogenesis
krd00052  Galactose metabolism
krd00500  Starch and sucrose metabolism
krd00520  Amino sugar and nucleotide sugar metabolism
krd00521  Streptomycin biosynthesis
krd01100  Metabolic pathways
krd01110  Biosynthesis of secondary metabolites
krd01120  Microbial metabolism in diverse environments
krd01200  Carbon metabolism
Module
krd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
krd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
krd_M00909  UDP-N-acetyl-D-glucosamine biosynthesis, prokaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:krd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A3780_16350 (glk)
   00052 Galactose metabolism
    A3780_16350 (glk)
   00500 Starch and sucrose metabolism
    A3780_16350 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    A3780_16350 (glk)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    A3780_16350 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    A3780_16350 (glk)
Enzymes [BR:krd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     A3780_16350 (glk)
SSDB
Motif
Pfam: Glucokinase PaaX_C
Other DBs
NCBI-ProteinID: APG19060
UniProt: A0A1T5HG51
LinkDB
Position
complement(3582592..3583557)
AA seq 321 aa
MTKYALVGDVGGTNARLALCDVDSGDISRAKTYSGLDYPSLEAVVRVYLEEHDVSVEDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFAHLEIINDFTAVSMAIPMLKKDHLIQFG
GGEAVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEGIILEELRAE
IGHVSAERVLSGPGLVNLYRAIVKSDGRLPENLQPKDVTERALADSCIDCRRALSLFCVI
MGRFGGNLALNLGTFGGVYIAGGIVPRFLDFFTASGFRGGFEDKGRFKSYVQDIPVYLIV
HDNPGLLGSGAHLRQTLGHFL
NT seq 966 nt   +upstreamnt  +downstreamnt
atgacaaagtatgctttagtgggagacgtgggcggtaccaacgcgcgcttagcgttgtgc
gatgtcgacagtggtgatatctcccgggccaaaacttattccggcctcgattacccgagc
ctggaagccgtagtgcgcgtttatcttgaagaacatgacgtcagcgtggaagacggctgc
atcgctattgcttgtccgattaccggcgactgggtggcgatgacgaatcacacatgggct
ttctcgattgcggaaatgaagaaaaacctcggctttgcgcatctggaaattattaatgat
tttaccgccgtatcgatggcgatcccgatgctgaaaaaagatcaccttatccagtttggc
ggcggtgaggcggtggaaggcaagccgattgctgtttacggcgctggtacgggtcttggc
gtagcacatctggtgcatgtcgataaacgctgggtgagcctgccgggcgaaggcggtcac
gtcgatttcgcaccgaacagtgaagaagaggggattatcctcgaagaattgcgggcggaa
atcggccatgtctccgccgaacgtgtgctctctggtcctgggctggtcaatctttaccgg
gcgattgtgaaatctgacggtcgtttaccggagaatctgcaacccaaagatgttaccgaa
cgggcgctggcggacagttgcattgactgccgccgcgcattgtcgttgttctgcgtcatt
atggggcgttttggcggtaacctggcgctgaatctcggtacattcggcggggtgtatatc
gcgggcgggatagtgccgcgcttccttgatttctttaccgcctccggtttccgcggcggc
tttgaagataaagggcgtttcaagtcctatgtgcaggacattccggtctatctgattgtg
cacgataaccccggcctgctcggctctggcgcacatctgcgccagacgctgggtcatttc
ctttaa

DBGET integrated database retrieval system