KEGG   Kosakonia radicincitans: A3780_17410Help
Entry
A3780_17410       CDS       T04579                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
krd  Kosakonia radicincitans
Pathway
krd03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:krd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    A3780_17410
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:krd03400]
    A3780_17410
Enzymes [BR:krd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     A3780_17410
DNA repair and recombination proteins [BR:krd03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     A3780_17410
 Prokaryotic type
     A3780_17410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: APG19255
UniProt: A0A5C1P7Q6
LinkDB All DBs
Position
3812222..3812911
Genome map
AA seq 229 aa AA seqDB search
MTTSLTWHDVLAEEKQQPYFINTLSTVAAERQSGMTIYPPQKDVFNAFRFTELGNVKVVI
LGQDPYHGPGQAHGLAFSVRPGIAIPPSLLNMYKELENTIPGFVRPQHGYLESWARQGVL
LLNTVLTVRAGQAHSHASLGWETFTDKVIALINEHREGVVFLLWGSHAQKKGAIIDKSRH
HVLRAPHPSPLSAHRGFFGCNHFALANQWLERHGEQPIDWMPTLPAETE
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctcattaacatggcatgatgtgctggcagaagaaaaacagcagccctacttt
attaacactctcagtacggttgcggctgagcggcagtccggaatgaccatctacccaccg
cagaaagatgtgtttaacgctttccgttttaccgaactgggcaacgttaaagtggtgatt
ctggggcaggatccctatcacggtcctggtcaggcacacggcctggcattttctgtgcgc
cccggtatcgccatcccaccttccctgctgaatatgtataaagagctggaaaacaccata
ccgggcttcgtgcggccgcagcatggttatctggagagctgggcgcgccagggcgtattg
ctgctcaacaccgtgctgacggtacgcgccggccaggcgcattcgcatgccagtctcggc
tgggaaacctttaccgacaaagtgatcgcactgattaatgaacatcgggaaggcgtcgtg
tttttactctggggttcgcatgcgcagaagaaaggggcgattatcgacaaatcccgccac
catgttttgcgcgcaccgcacccatcgccgctctctgcgcatcgcggtttctttggctgt
aatcactttgcgctggcaaatcagtggctggagcggcatggagagcagccgatcgactgg
atgccgactctgcccgcggaaaccgaataa

DBGET integrated database retrieval system