KEGG   Kosakonia radicincitans: A3780_21870
Entry
A3780_21870       CDS       T04579                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
krd  Kosakonia radicincitans
Pathway
krd00052  Galactose metabolism
krd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:krd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    A3780_21870
Enzymes [BR:krd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     A3780_21870
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C Methyltransf_25 TrkA_N 2-Hacid_dh_C UDPG_MGDP_dh_N Methyltransf_31 Pyr_redox_2 ADH_zinc_N_2 Met_10 CoA_binding PrmA Shikimate_DH 3HCDH_N MTS Pyr_redox Methyltransf_11 ThiF ELFV_dehydrog
Other DBs
NCBI-ProteinID: APG20079
LinkDB
Position
4732576..4733619
AA seq 347 aa
MKSVVIHAEGHVCVEERPEPQLQHDDDVKVRVVSSGLCGSDIPRIFAGGAHFYPITLGHE
FSGYVEACGAAINDLHAGDAVACVPLLPCFDCPECRREYFSLCKRYQFVGSRSDGGNAEY
IVVKRANLIALPKDMTIEDGAFIEPITVGLHAFHLAGGCENKNVIIVGAGTIGLLAMQCA
RALGAKSVTAIDINPDKLQLANELGATFTFNSSKQDVRAITAGLEEARFDQLVLETAGTP
QTVSLAIEIAGPRAQLALIGTLHHDLTLTAPVFGQILRKEMTLIGSWMNYSGPWPGEEWT
TATRLLTEKKLMLEPLIAHRGDPDSYARAVQNLNGAPMQGKILLRLD
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggttatccatgctgagggccacgtctgcgttgaagaacgcccggaacct
cagttgcagcacgatgatgatgtcaaagtcagggttgtcagctccggcctgtgcggttct
gacatcccgcgtatctttgctggtggcgcgcatttttacccaattaccctgggacatgaa
ttcagcggttatgttgaagcctgtggcgcggcaatcaacgatttacacgccggggatgca
gtggcatgcgtgccgctgctgccctgctttgattgcccggagtgccgccgcgagtacttc
tccttgtgcaagcgctaccagtttgtcggctcgcgcagcgatggcggtaatgccgaatac
atcgtagtgaaacgggcgaatctgatcgcgttgccgaaggatatgacgattgaagatggc
gcatttattgaacccatcaccgtcggcctgcatgccttccaccttgctggcggttgtgaa
aacaaaaacgtgatcattgtcggtgccggtaccattggcctgctggccatgcagtgcgca
cgggcgcttggtgccaaaagcgttaccgctatcgatatcaaccccgacaagctgcaactg
gcaaacgaactcggcgcaaccttcaccttcaatagcagcaagcaggatgtaagggcgatt
accgcaggcctggaagaggcgcgtttcgaccagttggtactggaaacggcaggaacaccg
caaaccgtctcactggcaatcgaaatcgccgggccgcgcgcccagctggcattgatcggt
accctgcatcacgacctgacgttaaccgcgcccgtgttcggccaaattctgcgcaaagag
atgaccctgattggcagctggatgaactactccggcccgtggccgggggaagagtggaca
acggctacacgtctgctgacagagaaaaaactgatgctggagccgttgatcgcccatcgc
ggcgatccggacagttacgcccgtgcagtacagaaccttaacggtgcgccgatgcagggc
aaaatcctgttacggctcgattaa

DBGET integrated database retrieval system