KEGG   Kosakonia radicincitans: A3780_25810Help
Entry
A3780_25810       CDS       T04579                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
krd  Kosakonia radicincitans
Pathway
krd00071  Fatty acid degradation
krd00280  Valine, leucine and isoleucine degradation
krd00281  Geraniol degradation
krd00310  Lysine degradation
krd00362  Benzoate degradation
krd00380  Tryptophan metabolism
krd00410  beta-Alanine metabolism
krd00640  Propanoate metabolism
krd00650  Butanoate metabolism
krd00903  Limonene and pinene degradation
krd00930  Caprolactam degradation
krd01100  Metabolic pathways
krd01110  Biosynthesis of secondary metabolites
krd01120  Microbial metabolism in diverse environments
krd01130  Biosynthesis of antibiotics
krd01200  Carbon metabolism
krd01212  Fatty acid metabolism
Module
krd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:krd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A3780_25810 (fadB)
   00650 Butanoate metabolism
    A3780_25810 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A3780_25810 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A3780_25810 (fadB)
   00310 Lysine degradation
    A3780_25810 (fadB)
   00380 Tryptophan metabolism
    A3780_25810 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A3780_25810 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A3780_25810 (fadB)
   00281 Geraniol degradation
    A3780_25810 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A3780_25810 (fadB)
   00930 Caprolactam degradation
    A3780_25810 (fadB)
Enzymes [BR:krd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     A3780_25810 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     A3780_25810 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     A3780_25810 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     A3780_25810 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: APG20806
LinkDB All DBs
Position
complement(5559354..5561543)
Genome map
AA seq 729 aa AA seqDB search
MLYKGNNLYLNWLEDGIAELVFDAPGSVNKLDTATVASLGEALAVLEKQSDLKGLLLRSE
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRLLGADSALEIIAAGKDVDAEQALK
IGLVDGIVKPEKLREGAIAILRQAINGDLDWKAKRQPKLEPLKLSKIEAAMSFTIAKGMV
MQTAGKHYPAPITAVKTIEAAARFGRDEALKLENQSFVPLAHTNEARALVGIFLNDQYVK
GQAKKLTKNVETPKQAAVLGAGIMGGGIAYQSAWKGVPVLMKDINEKSLALGINEAGKLL
NKQLERGKIDGLKLASVIATIQPTLEYAGFERADVVVEAVVENPKVKKAVLAETEDKVRP
DTVLASNTSTIPISELASVLKRPENFCGMHFFNPVHRMPLVEVIRGEKTSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDAHRFGQKNGLGFWRYKEDSKGKP
KKEEDSAVDSMLAEISKGKQDFSDEEIIVRMMIPMVNEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQHYQHLGPLYEVPAGLREKARRNEPYYPAVEPA
RPVGELKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggcaataacctgtacctaaactggctggaagatggcatcgcggaactg
gtattcgatgcgcccggctcagttaacaagcttgataccgccaccgtcgccagccttggc
gaagcgctggccgtactggaaaagcaatcagatttaaaagggctgctgctgcgttcagag
aaagcggcctttattgtcggggccgatatcaccgaattcctctccctgttcctcgtgccg
gaagagcagttgagccagtggctgcactttgccaacagcgtgtttaaccgcctggaagat
ttgcccgtcccaacgatctccgcggtgaatggctatgcgctcggtggcggctgcgaatgc
gtgctggcgacagactatcgcctggcgacgccggacctgcgtattggcctgccggaaacc
aaacttggtatcatgccaggctttggcggttcagtacgcatgccacgcctgctgggtgca
gacagcgcactggaaatcatcgcggccgggaaagatgtcgatgccgaacaagcgctgaaa
atcggcctggtggatggcattgtgaagccggaaaaactgcgtgaaggtgccattgccatt
ctgcgacaggccattaacggcgatctggactggaaagcaaaacgtcagccgaagctggag
ccactgaagctcagcaaaattgaagctgccatgagctttactattgccaaaggcatggtg
atgcaaacagccgggaagcactatccggcaccgatcacggcggtcaaaaccattgaagct
gcggcaagatttggccgcgacgaagcgctgaagctggaaaaccagagcttcgttccgctc
gcccataccaacgaggcccgtgcgctggtcgggattttcctgaacgaccaatatgtaaaa
ggtcaggcgaagaaactgaccaaaaatgtcgaaacgcccaaacaagctgcggtacttggc
gcaggcattatgggcggcggcattgcttaccagtcagcctggaaaggcgtaccggtatta
atgaaggatatcaacgagaaatcccttgcactcggcattaatgaagcaggcaagctgctg
aacaaacagctcgagcgcggcaaaatcgatggtctaaaactggccagcgtgattgcgacc
attcagccaacactggagtatgccggttttgaacgcgccgacgtggtggtcgaagcggtc
gtggaaaacccgaaagtgaaaaaagcggtgctggcggaaacagaggacaaagtccgtccg
gataccgtactggcatcaaatacctccaccattcccatcagtgaactcgccagcgtgctg
aaacgcccggaaaatttctgcggcatgcacttcttcaacccggtacaccgtatgccgctg
gttgaagtgattcgcggagagaaaacgtccgatgaaaccatcgccaaagtagtggcctgg
gcgagcaaaatgggcaaaacgccgatcgtggtcaatgactgcccaggtttcttcgtcaac
cgcgtactgttcccttactttgccgggtttagccagttgctgcgcgacggcgcggatttc
cgcaaagtcgacaaagtgatggagaagcagttcggctggccgatgggcccggcgtatctg
ctggatgttgtgggtattgataccgcacatcacgcccaggcggtgatggcggccggtttc
ccgcagcgcatgcagaaagattatcgcgatgccatcgatgcgctgtttgacgcacaccgt
ttcgggcagaaaaacgggctcggtttctggcgctataaagaagacagcaaaggcaaaccg
aagaaagaagaagacagcgccgttgacagcatgctggccgaaatcagcaaaggcaaacag
gatttcagcgatgaagagattattgtccgcatgatgattccaatggtcaatgaagtggtg
cgttgtctggaagaagggattatcgccagccctgccgaagcggatatggcgctggtgtat
ggtcttggcttcccgccgttccacggcggcgcgttccgctggctggatacgcttggcagc
gcaaaatacctcgatatggcacagcactatcagcatctcgggccgctgtatgaagtaccg
gcggggctgcgcgaaaaagcgcgccgcaacgagccttattaccctgcggtagaacctgcg
cgcccagtgggcgagttaaaaacggcttaa

DBGET integrated database retrieval system