KEGG   Komagataeibacter rhaeticus: GWK63_06650Help
Entry
GWK63_06650       CDS       T06497                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kre  Komagataeibacter rhaeticus
Brite
KEGG Orthology (KO) [BR:kre00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GWK63_06650 (ahpF)
Enzymes [BR:kre01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GWK63_06650 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA DAO Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored Thi4 AlaDh_PNT_C Glutaredoxin FAD_binding_3 K_oxygenase FMO-like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: QIP35185
LinkDB All DBs
Position
1472049..1473635
Genome map
AA seq 528 aa AA seqDB search
MLQDPIKTQLKGYLAGLAHPVVLEASLDDSPKSREMHELLHEVAALSDRVQVSEAGQATR
RPSFVIRREGGRAGVSFAAIPMGHEFTSFVLALLQVGGHPPKLSDDEIAQIKALPGPYHF
ETYVSLSCQNCPDVVQALNAMSVLNPNISNVTIDGALFQDEVTAKNIMSVPQVYLNGAPF
ETGRADIEQLLAKLDADAPRRAAEKLKDIAPFDVLIIGGGPAGASAAVYAARKGLRTGLV
AERFGGQVMDTAGIENFISIPETDGPKLAAALEAHVRAYDVEIITGQQAKELFPAPQPGG
LHGVALESGAILHARTVILATGAHWRHLGVPGEEEYRNKGVAYCPHCDGPFYKGKRVAVA
GGGNSGVEAAIDLAGIVAHVTLLQRGSHLKADKVLQDKLRTLSNVTVLTEALTTRIEGNG
RNVTGLTYRGGDGADHHVDLEGVFVQIGLLPNTGWLKNTLRLSDFGEIVVNDHGATSVPG
VFAAGDATTTPYKQIVIAIGAGATAALSAFDYLIRVPVAAAQPVPAPV
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaagatcccatcaagacgcagctgaagggctatctggcagggcttgcgcacccc
gtcgtgcttgaggcctcgctggatgacagcccgaaatcgcgcgagatgcatgaactcctg
catgaggtcgccgccctttccgacagggtgcaggtctccgaagcgggacaggccacaagg
cggccctccttcgtcatcaggcgcgaagggggcagggcgggggtgagctttgccgccatt
cccatggggcatgagttcacgtccttcgtgctggcgctgctgcaggttgggggccatccg
cccaaactgtccgatgatgaaatcgcgcagataaaggcgctgccggggccataccatttc
gagacctatgtctcgctgtcgtgccagaactgccccgatgtggtccaggcgctcaatgcc
atgagcgtgctcaaccccaatatcagcaacgtcacgattgacggggcgctgttccaggac
gaggtcacggcaaaaaacatcatgtccgtgccgcaggtctacctcaatggcgcgccgttc
gagaccgggcgcgccgacatcgagcagcttctggccaaactggacgccgatgcgccccgg
cgtgcggcggaaaagctgaaggatatcgccccgtttgacgtgctgatcatcggcggtggc
ccggcgggggcatcggctgcggtctatgccgcgcgcaaggggctgcgcacggggctggtg
gccgaacgttttggcggccaggtcatggatacggcggggatcgagaacttcatttccata
cccgaaaccgatggtccgaagcttgccgcggcactggaggcgcatgtgcgcgcctatgac
gtggaaatcatcacgggccagcaggcaaaggaactgttccccgccccgcagcccggcggg
ctgcacggggtggcgctggaaagcggggcgatcctgcacgcccgcacggtcatactggcc
accggcgcccactggcggcatctgggcgtaccgggggaggaggaataccgcaacaagggc
gtggcctactgcccgcactgcgatggtcccttctacaagggcaagcgtgtggccgtggcg
ggcggtggcaatagcggggtggaagccgcgatcgaccttgccggtatcgtggcgcatgtc
acgctgctgcagcgcggctcacacctgaaagccgacaaggtgcttcaggacaagctgcgc
accctgtccaacgtcacggtcctgaccgaggccctgaccacgcgcatcgaaggtaacggc
aggaacgtaaccggcctgacctatcgcggcggcgacggggcggaccaccatgtggacctg
gagggcgtgttcgtgcagatcggcctgctgcccaataccggctggctgaagaatacgctc
aggctcagcgatttcggggagatcgtggtcaacgaccatggtgccacgtccgtccccggt
gtgttcgcggctggcgatgcgacgacaacgccctacaagcagatcgtcattgccatcggg
gctggggcaacggccgcgctttcggcttttgactacctgatccgcgtgcccgtcgcggcg
gcacagccggttccagccccggtataa

DBGET integrated database retrieval system