KEGG   Kocuria rhizophila: KRH_06630Help
Entry
KRH_06630         CDS       T00701                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
krh  Kocuria rhizophila
Pathway
krh00473  D-Alanine metabolism
krh01100  Metabolic pathways
krh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:krh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    KRH_06630 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    KRH_06630 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:krh01011]
    KRH_06630 (alr)
Enzymes [BR:krh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     KRH_06630 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:krh01011]
 Precursor biosynthesis
  Racemase
   KRH_06630 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C TsaE AAA_25
Motif
Other DBs
NCBI-ProteinID: BAG29010
NITE: KRH_06630
UniProt: B2GJ40
LinkDB All DBs
Position
717873..719810
Genome map
AA seq 645 aa AA seqDB search
MSEMTSEQNRQPSERSAVVDLAAVRHNVGRLLELARGRTLIAVVKANAYGHGAPQVARAA
LEAGAHMLGTAHVSEALALRAEGITAPVLAWLHTPSTDFAAAVREDVRLGVSGGELDAVL
AAAREAGRPAVVHLKLDSGLGRNGATPEQWPALVRRVREAEGEGLLSVEGIFTHLAVADE
PARPETAEQLATLTTAVRTAREAGLSPTMVHAANTPGLLSAADREDPDAILRDAVRVGLG
LYGLSPFADRTPEDFGLVPAMTLRTRVANVKDVPAGAGVSYGLTYRTEGPTRLALIPLGY
ADGVPRVATGAPVRIGNRLHPVVGRIAMDQCVVDLSRSRPVTEAAGKPGAAREPTVRIGD
EAVLFGAGSNPSVTDWADAAGTINYEVVTRLSPRVPREHVGLEPQRDSDRSRSVEHGGHP
GAEPVDGPGADRDHGAGAGPGGVVPGDGAQDGPGAGAAGENWSITRELASAEETRALAAA
LAPHLRAGDLVLLNGELGAGKTTFTQGLGAGLGVREGIISPTFVLARRHPNLADGPRPGG
PDLVHVDAYRLGSAEDVESIDLEDTLDTCVTVVEWGTSKVEHLSASRLVVDIERARGAQA
APEQADLAGVLAQLGAQWEEDASAGEVRQITLRGVGPRWTEPPRV
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgagatgacctcggagcagaaccggcagcccagcgagcgcagcgcggtggtggac
ctcgcggcggtgcgccacaacgtggggcggctgctcgagctggcgcgggggcgcaccctg
atcgcggtggtcaaggcgaacgcctacggtcacggcgccccgcaggtggcccgtgcggcg
ctcgaggcgggtgcgcacatgctcggcacggcccacgtgtccgaggcgctcgcgctgcgc
gcggaggggatcacggcccccgtgctcgcgtggctgcacaccccgtcgaccgacttcgcc
gcggccgtgcgggaggacgtgcggctgggcgtgagcgggggagagctcgacgccgtgctg
gccgccgcccgtgaggccggccgcccggcggtggtccacctcaagctcgactcggggctg
gggcgcaacggtgccacgcccgagcagtggcccgccctggtccggcgcgtgcgggaggcc
gagggggagggtctgctctcggtggaggggatcttcacgcacctcgcggtcgcggacgaa
cccgcccgccccgagacggccgagcagctcgccaccctcaccaccgcggtgcgcacggca
cgggaggccgggctgagccccacgatggtgcacgccgccaacacccccgggctgctctcg
gccgcggaccgggaggaccccgacgcgatactgcgggacgccgtgcgcgtgggcctggga
ctgtacgggctgagccccttcgcggaccgcacccccgaggacttcgggctggttccggcc
atgacgctgcggacccgcgtggccaacgtgaaggacgtccccgccggagcgggggtctcc
tacgggctcacgtaccgcacggagggccccacccggctcgcactgattccgctcggctac
gcggacggtgtgccgcgcgtggccacgggcgccccggtgcggatcgggaaccggctgcac
cccgtggtgggccggatcgccatggaccagtgcgtcgtggacctctcccggagccggccc
gtgacggaggccgcggggaagcccggtgccgctcgggagcccaccgtgcggatcggggac
gaggcggtgctcttcggtgcgggctcgaacccgtccgtgacggactgggcggacgcggcg
ggcaccatcaactacgaggtggtcacccgcctctccccgcgcgttccccgcgagcacgtg
gggctggagccgcagcgcgacagcgaccggagccggagcgtggagcacggtgggcacccc
ggcgcggagcccgtggatggccccggcgcggaccgcgaccacggggcgggtgccgggccg
ggcggcgtcgtgcccggggacggcgcgcaggacggtcccggggcgggtgccgcgggtgag
aactggagcatcacgcgggagctcgcgagcgcggaggagacccgggcgctcgcggcggcg
ctcgccccgcacctgcgcgcgggggacctcgtgctgctcaacggggagctcggcgcgggc
aagaccacgttcacgcagggcctcggcgcggggctgggggtgcgcgagggcatcatctcg
cccacgttcgtgctggcccgccgccaccccaacctggcggacgggccgcgcccgggcggc
ccggacctcgtgcacgtggacgcgtaccggctgggctcggccgaggacgtcgagagcatc
gacctcgaggacaccctggacacgtgcgtcacggtggtggagtggggcacctccaaggtc
gagcacctgagtgcgtcccggctggtggtcgacatcgagcgtgcccgcggcgcgcaggcg
gcccccgagcaggcggacctggcgggcgttctcgcgcagctcggcgcgcagtgggaggag
gacgcctcggcgggggaggtccggcagatcaccctgcggggcgtgggcccgcgctggacc
gaaccgccgcgcgtgtga

DBGET integrated database retrieval system