KEGG   Kocuria rhizophila: KRH_08030Help
Entry
KRH_08030         CDS       T00701                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
krh  Kocuria rhizophila
Pathway
krh00020  Citrate cycle (TCA cycle)
krh00480  Glutathione metabolism
krh01100  Metabolic pathways
krh01110  Biosynthesis of secondary metabolites
krh01120  Microbial metabolism in diverse environments
krh01130  Biosynthesis of antibiotics
krh01200  Carbon metabolism
krh01210  2-Oxocarboxylic acid metabolism
krh01230  Biosynthesis of amino acids
Module
krh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
krh_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:krh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KRH_08030 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KRH_08030 (icd)
Enzymes [BR:krh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     KRH_08030 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: BAG29150
NITE: KRH_08030
UniProt: B2GKD0
LinkDB All DBs
Position
complement(865521..867734)
Genome map
AA seq 737 aa AA seqDB search
MPKIIYTETDEAPMLATYSFKPMVEAFASTAGVEVETRDISLAARILAQFPDRLTDAQRV
PDTLGELGELAKTPEANIVKLPNISASIPQLKAAIKELQADGYDLPDYPEDASSDEAKDV
RARYDRVKGSAVNPVLREGNSDRRAPKAVKEYAKKHPHTMGAWSEDSRTNVATLGHDDFR
TNEQSVVMPADDTLTIQLVSDGKTTVLKQSVPVLAGEVVDATFMSAAALDEFLTAQVVRA
KEEGILFSAHLKATMMKVSDPIIFGHVVSAFFQDVMERYGADLAKAGLSPNDGLAGILSG
LDALENGAEIKAAFQEAIDNGPELAYVNSDKGITNLHVPSDVIVDASMPAMIRTSGQMWG
REGEQKDTLAVLPDSSYAGVYQTVIDDCRENGAYDPTTMGTVPNVGLMAQKAEEYGSHDK
TFEITEAGTVQVVNSAGNVLMSHDVQPGDIWRACQAKDAPIKDWVQLAVRRSRESGMPAV
FWLDESRAHDRNLIEKVNTYLAQEDTDGLDLRILSPVEATQFTIDRIRRGEDTISVTGNV
LRDYLTDLFPILELGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVQQLQAENHLRWDSLG
EFLALAASFEHLATRFDNPKAQVLADTLDRATGTFLNENKSPSRKVNELDNRGSHFYLAM
YWAEELARQTEDAELAQAFREVASELRANEETINAELLGVQGSPADLGGYYWPKPELVSG
VMRPSATLNRIVDSLTA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagatcatctacaccgagaccgacgaagcgcccatgctggccacgtactcgttc
aagcccatggtcgaggcgttcgcgtccacggccggggtggaggtcgagacccgggacatc
tccctggccgcccgcatcctggcgcagttcccggaccggctcacggacgcgcagcgcgtc
ccggacaccctcggggagctcggggagctcgcgaagacgccggaggccaacatcgtgaag
cttcccaacatctcggcctccatcccgcagctcaaggccgccatcaaggagctgcaggcc
gacggctacgacctgccggactacccggaggacgcctcctcggacgaggccaaggacgtc
cgcgcgcgctacgaccgcgtgaagggctccgccgtgaacccggtgctgcgcgagggcaac
tcggaccgccgggcgcccaaggccgtcaaggagtacgccaagaagcacccgcacactatg
ggcgcgtggtccgaggactccaggaccaacgtggccacgctgggccacgacgacttccgc
accaacgagcagtccgtcgtgatgcccgcggacgacaccctcaccatccagctggtcagc
gacggcaagaccaccgtgctcaagcagtcggtgcccgtgctcgccggtgaggtggtggac
gccacgttcatgagcgccgccgccctggacgagttcctgacggcccaggtggtccgcgcc
aaggaggagggcatcctgttctccgcccacctcaaggccaccatgatgaaggtctcggac
cccatcatcttcggccacgtggtcagcgcgttcttccaggacgtcatggagcgctacggc
gcggacctggccaaggccggactctcccccaacgacggactggccgggatcctctcgggc
ctggacgccctggagaacggcgccgagatcaaggccgcgttccaggaggccatcgacaac
ggccccgagctcgcctacgtgaactcggacaagggcatcaccaacctgcacgtgccctcg
gacgtgatcgtggacgcctccatgcccgcgatgatccgcacctccggccagatgtggggc
cgcgagggcgagcagaaggacaccctggccgtgctgccggactcctcctacgccggtgtg
taccagaccgtgatcgacgactgccgcgagaacggcgcgtacgaccccaccaccatgggc
accgtgccgaacgtcggtctcatggcgcagaaggccgaggagtacggctcccacgacaag
accttcgagatcaccgaggccggcaccgtgcaggtggtcaactccgccgggaacgtgctc
atgtcccacgacgtccagccgggtgacatctggcgtgcgtgccaggccaaggacgccccc
atcaaggactgggtgcagctggccgtgcgccgctcccgcgagtccgggatgcccgcggtg
ttctggctggacgagtcccgcgcccacgaccgcaacctgatcgagaaggtcaacacctac
ctcgcccaggaggacaccgacgggctggacctccgcatcctctcccccgtggaggccacc
cagttcaccatcgaccgcatccgccgcggcgaggacaccatctcggtgaccggcaacgtg
ctgcgcgactacctcacggacctgttccccatcctggaactgggcacctccgcgaagatg
ctctcgatcgtgccgctcatgaacggcggcggcctcttcgagaccggtgccggcggctcg
gcccccaagcacgtgcagcagctgcaggcggagaaccacctgcgctgggactccctcggt
gagttcctggcgcttgcggcttccttcgagcacctcgccacgcgcttcgacaaccccaag
gcgcaggtcctcgcggacaccctggaccgggccacgggcacgttcctgaacgagaacaag
tccccgtcccgcaaggtcaacgagctggacaaccgcgggtcgcacttctacctggccatg
tactgggccgaggagctcgcccggcagaccgaggacgccgagctggcccaggccttccgg
gaggtggcctccgagctgcgcgccaacgaggagaccatcaacgccgagctgctcggcgtg
cagggctcccccgcggacctcggcggctactactggcccaagccggagctggtctcggga
gtcatgcgcccgtccgccacgctgaaccggatcgtggactccctcacggcctga

DBGET integrated database retrieval system