KEGG   Kocuria rhizophila: KRH_09790
Entry
KRH_09790         CDS       T00701                                 

Gene name
atpE
Definition
(GenBank) ATP synthase subunit c
  KO
K02110  F-type H+-transporting ATPase subunit c
Organism
krh  Kocuria rhizophila
Pathway
krh00190  Oxidative phosphorylation
krh01100  Metabolic pathways
Module
krh_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:krh00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    KRH_09790 (atpE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:krh00194]
    KRH_09790 (atpE)
Photosynthesis proteins [BR:krh00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   KRH_09790 (atpE)
SSDB
Motif
Pfam: ATP-synt_C DUF4233
Other DBs
NCBI-ProteinID: BAG29326
NITE: KRH_09790
UniProt: B2GLY5
LinkDB
Position
1066722..1066925
AA seq 67 aa
MEGSLSVIGYGLAAIGGGIGVGLIFAAYMQSVARQPESQRVLQPMLFMGFAVVEALAILG
LVLAFIK
NT seq 204 nt   +upstreamnt  +downstreamnt
atggaaggttcgcttagcgtcattggctacggtctcgctgccatcggcggtggcatcggt
gtgggtctcatcttcgctgcctacatgcagtccgtggcccgccagcccgagtcccagcgc
gtcctgcagcccatgctgttcatgggcttcgcagtggtcgaggccctggccatcctgggc
ctggtcctcgcgttcatcaagtag

DBGET integrated database retrieval system