KEGG   Kocuria rhizophila: KRH_11600Help
Entry
KRH_11600         CDS       T00701                                 

Gene name
nrdE
Definition
(GenBank) ribonucleoside-diphosphate reductase alpha subunit
  KO
K00525  ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Organism
krh  Kocuria rhizophila
Pathway
krh00230  Purine metabolism
krh00240  Pyrimidine metabolism
krh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:krh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    KRH_11600 (nrdE)
   00240 Pyrimidine metabolism
    KRH_11600 (nrdE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:krh03400]
    KRH_11600 (nrdE)
Enzymes [BR:krh01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     KRH_11600 (nrdE)
DNA repair and recombination proteins [BR:krh03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    KRH_11600 (nrdE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_lgC RNR_N Ribonuc_red_lgN
Motif
Other DBs
NCBI-ProteinID: BAG29507
NITE: KRH_11600
UniProt: B2GGT4
LinkDB All DBs
Position
1281011..1283170
Genome map
AA seq 719 aa AA seqDB search
MSVEPGHEDPTCPEQYRGLGYHELNALLNLYDAEGNIQFEADRQAARQYFLQHVNKNTVF
FHDLEEKLKYLVDHQYYEAEVLEKYSVEFIKELSKQAYGYKFRFQTFLGAFKFYTSYTLK
TFDGQRYLERFEDRVVMVSLYLADGDETLAKRLVGEIISGRFQPATPTFLNAGKKQRGEL
VSCFLVRFEDNMESIGRNINSALQLSKRGGGVAFALTNLRESGAPIKMIENQSSGVIPVM
KLLEDSFSYANQLGARQGAGAVYLHAHHPDILNFLDTKRENADEKIRIKTLSLGVVIPDI
TFELAKKNQDMYLFSPYDVERIYGMPFADVNVSEKYHEMVDDSRITKTKINAREFFQTVA
EVQFESGYPYIMFEDTVNRANPIDGKIIMSNLCSEILQVSEPSVYNEDLTYAEVGKDISC
NLGSMNIAMAMESPDFGASIETAIRGLTAVSDMSNIDSVPSIRRGNQMSHAVGLGQMNLH
GYLAKEHVFYGSEEGVDFTNMYFYAVTYHAIRASNLIAKERGESFVGFEKSDYANGTYFD
KYIDGTWEPATARVRELFARAGVALPTAQDWRELREKVMADGMYNQNLQAVPPTGSISYI
NNSTSSIHPIASRIEIRKEGKLGRVYYPAPFMNDENLEYFQDAYEIGFEKIIDTYAAATQ
HVDQGLSLTLFFKDTATTRDINRAQIYAWRKGIKTMYYSRIRQLALEGTEVEGCVSCML
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtcgagcccggtcacgaggatcccacgtgccccgagcagtaccggggtctgggc
taccacgagctcaacgccctgctgaacctctacgacgccgagggcaacatccagttcgag
gcggaccgtcaggccgcgcggcagtacttcctgcagcacgtcaacaagaacaccgtgttc
ttccacgacctcgaggagaagctcaagtacctggtggaccaccagtactacgaggccgag
gtgctcgagaagtacagcgtggagttcatcaaggagctgtccaagcaggcgtacggctac
aagttccgcttccagaccttcctgggcgcgttcaagttctacacgtcctacacgctgaag
acgttcgacggacagcgctacctggagcgcttcgaggaccgcgtggtcatggtctccctc
tacctcgcggacggggacgagaccctggcgaagcgtctggtgggcgagatcatctccggt
cgcttccagccggccactcccacgttcctcaacgcgggcaagaagcagcgcggcgagctg
gtctcgtgcttcctggtgcgcttcgaggacaacatggagtccatcgggcgcaacatcaac
tcggcgctgcagctgtccaagcgcggcggcggtgtggcgttcgcgctgacgaacctgcgc
gagtccggtgcgccgatcaagatgatcgagaaccagtcctcgggcgtcatcccggtcatg
aagctgctggaggactcgttctcctacgcgaaccagctgggggcccgtcagggcgcgggt
gctgtgtaccttcacgcccaccacccggacatcctcaatttcctggacaccaagcgcgag
aacgcggacgagaagatccgcatcaagaccctctcgctcggcgtcgtcatcccggacatc
acgttcgagctggcgaagaagaaccaggacatgtacctgttctcgccgtacgacgtggag
cgcatctacggaatgcccttcgcggacgtgaacgtgagcgagaagtaccacgagatggtg
gacgactctcggatcacgaagaccaagatcaacgcccgcgagttcttccagaccgtcgcg
gaggtgcagttcgagtccggctacccgtacatcatgttcgaggacacggtgaaccgcgcc
aacccgatcgacggcaagatcatcatgtccaacctgtgctccgagatcctgcaggtctcc
gagccctcggtctacaacgaggacctcacctatgcggaggtgggcaaggacatctcgtgc
aacctggggtccatgaacatcgccatggccatggagtccccggacttcggggcgagcatc
gagaccgcgatccgcggcctcaccgcagtgtcggacatgtccaacatcgactccgtgccc
tcgatccgccgcggcaaccagatgtcccacgcggtgggcctgggccagatgaacctgcac
gggtacctggccaaggagcacgtgttctacggttccgaggagggcgtggacttcacgaac
atgtacttctacgccgtgacgtaccacgcgatccgggcgtcgaacctgatcgccaaggag
cgcggggagtccttcgtgggcttcgagaagtccgactatgcgaacggcacgtactttgac
aagtacatcgacggcacgtgggagcctgcgaccgcccgcgtccgcgagctttttgcgcgc
gccggtgtggcgctgcccaccgcgcaggactggcgtgagctgcgcgagaaggtcatggcg
gacgggatgtacaaccagaacctgcaggccgtgccgcccacgggttccatctcgtacatc
aacaactccacctcctcgatccacccgatcgcctcgcgcatcgagatccgcaaggagggc
aagctggggcgcgtgtactacccggcgcccttcatgaatgacgagaacctggagtatttc
caggacgcgtacgagatcggcttcgagaagatcatcgacacgtacgccgcggccacgcag
cacgtggaccagggcctgtccctgacgctgttcttcaaggacaccgccaccacgcgtgac
atcaaccgggcgcagatctacgcgtggcgcaagggcatcaagaccatgtactactcgcgg
atccgccagctggcgctcgagggcacagaggtcgagggctgcgtgtcctgcatgctgtga

DBGET integrated database retrieval system