KEGG   Kocuria rhizophila: KRH_17920Help
Entry
KRH_17920         CDS       T00701                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
krh  Kocuria rhizophila
Pathway
krh00020  Citrate cycle (TCA cycle)
krh00190  Oxidative phosphorylation
krh00650  Butanoate metabolism
krh01100  Metabolic pathways
krh01110  Biosynthesis of secondary metabolites
krh01120  Microbial metabolism in diverse environments
krh01130  Biosynthesis of antibiotics
krh01200  Carbon metabolism
Module
krh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
krh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
krh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:krh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KRH_17920 (sdhA)
   00650 Butanoate metabolism
    KRH_17920 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    KRH_17920 (sdhA)
Enzymes [BR:krh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     KRH_17920 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     KRH_17920 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 HI0933_like DAO FAD_oxidored GIDA Cytochrom_C1
Motif
Other DBs
NCBI-ProteinID: BAG30139
NITE: KRH_17920
UniProt: B2GM23
LinkDB All DBs
Position
2032335..2034086
Genome map
AA seq 583 aa AA seqDB search
MQVHKYDVVIVGAGGAGMRAAIESGQRARTAVLTKLYPTRSHTGAAQGGMCAALANVEED
NWEWHTFDTVKGGDYLVDQDAAEVMAKEAIDAVLDLEHMGLPFNRTPEGKIDQRRFGGHT
RDHGKNPVRRACYAADRTGHMILQTLYQTCIKHNVEFFNEYYVLDLIMVDTPEGRRPAGV
VAYELATGELHVFQAKSVVFASGGAGKVFKTTSNAHTLTGDGMAIAFRNGLPLEDMEFVQ
FHPTGLAGLGILVSEAARGEGGILRNSEGERFMERYAPTIKDLAPRDIVARSMANEVREG
RGCGPNKDYVLLDLTHLEPAHIDAKLPDITEFARTYLGVEPYTEPVPVFPTAHYCMGGIP
TDIKGEVFQDSETTIPGLYAAGEVACVSVHGSNRLGTNSLLDINVFGKRAGIYAAEYAQS
AEFLPVPDDAEARTVALLDNARSPHGNEKVAAIRKDLQDTMDLNMQVFRTAETIQKALDD
IAALEERYANISIQDQGKRFNLDLLEAVELGFLLELAKVMSVAALHREESRGGHFREDFP
DRDDENFMVHSMVYEDPTSATAGIRQETKPVIMTRYEPMERKY
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgcaggttcacaagtacgatgtggtaatagtcggcgccggcggcgccggcatgcgtgcc
gccattgagtccggccagcgcgcccgcactgccgtactgaccaagctctaccccacccgg
tcccacaccggcgcagcccagggcggcatgtgcgcggccctcgcgaacgtcgaggaggac
aactgggagtggcacaccttcgacaccgtcaagggtggcgactacctggtggaccaggac
gccgcggaggtcatggccaaggaggccatcgacgccgtgctcgacctcgagcacatgggg
ctgccgttcaaccgcacccccgagggcaagatcgaccagcgccgcttcggcggccacacc
cgcgaccacggcaagaaccccgtgcgccgcgcgtgctacgcggccgaccgcaccggtcac
atgatcctgcagaccctctaccagacgtgcatcaagcacaacgtggagttcttcaacgag
tactacgtgctggacctcatcatggtggacaccccggaggggcgtcgcccggccggtgtg
gtggcctacgagctcgccaccggtgagctgcacgtgttccaggccaagtccgtggtcttc
gcctccggcggtgcgggcaaggtcttcaagaccacctccaacgcgcacaccctcaccggt
gacggcatggccatcgccttccgcaacggcctgccgctggaggacatggagttcgtgcag
ttccaccccacgggcctcgcgggcctgggcatcctcgtctccgaggccgcccgcggcgag
ggtggcatcctgcgcaactcggagggcgagcgcttcatggagcgctacgcccccaccatc
aaggacctcgcgccgcgtgacatcgtggcccggtccatggccaacgaggtgcgcgagggc
cgcggctgcggtcccaacaaggactacgtgctgctggacctcacccacctggagccggcg
cacatcgacgccaagctgccggacatcacggagttcgcgcgcacctacctgggcgtggag
ccctacaccgagcccgttccggtgttccccaccgcccactactgcatgggcgggatcccc
accgatatcaagggcgaggtcttccaggactccgagaccaccatccccgggctctacgcc
gcgggcgaggtggcctgcgtgtccgtgcacggctccaaccgcctgggcaccaactcgctg
ctggacatcaacgtgttcggcaagcgcgccggcatctacgcggcggagtacgcgcagagc
gccgagttcctgcccgtgccggacgacgccgaggcgcgcaccgtggcgctgctggacaac
gcccgcagcccccacggcaatgagaaggtcgcggccatccgcaaggacctgcaggacacc
atggacctcaacatgcaggtgttccgcaccgcggagaccatccagaaggccctcgacgac
atcgccgcgctcgaggagcgctacgcgaacatctccatccaggaccagggcaagcgcttc
aacctggacctgctggaggctgtggagctgggcttcctgctggagctggccaaggtgatg
tccgtggccgccctgcaccgagaggagtcccgcggcgggcacttccgcgaggacttcccc
gaccgcgacgacgagaacttcatggtccactccatggtctacgaggacccgacgtccgcc
accgcgggcatccggcaggagaccaagccggtgatcatgacccgttacgagccgatggag
cgtaagtactga

DBGET integrated database retrieval system