KEGG   Kocuria rhizophila: KRH_17930Help
Entry
KRH_17930         CDS       T00701                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
krh  Kocuria rhizophila
Pathway
krh00020  Citrate cycle (TCA cycle)
krh00190  Oxidative phosphorylation
krh00650  Butanoate metabolism
krh01100  Metabolic pathways
krh01110  Biosynthesis of secondary metabolites
krh01120  Microbial metabolism in diverse environments
krh01130  Biosynthesis of antibiotics
krh01200  Carbon metabolism
Module
krh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
krh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
krh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:krh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KRH_17930 (sdhB)
   00650 Butanoate metabolism
    KRH_17930 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    KRH_17930 (sdhB)
Enzymes [BR:krh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     KRH_17930 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     KRH_17930 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4 Fer4_4 Fer4_18 Fer4_6 Fer4_20 Fer4_2 Fer4_15 Fer4_16 Fer4_21
Motif
Other DBs
NCBI-ProteinID: BAG30140
NITE: KRH_17930
UniProt: B2GM24
LinkDB All DBs
Position
2034086..2034868
Genome map
AA seq 260 aa AA seqDB search
MSTAVTENQNQDAQQPAPEGEESIPTYDVVLRVRRYDPEFESEAHWDEWPLTMYGTDRVL
DALHKVKWELDGSLSFRRSCAHGVCGSDAMRINGRNRLACKTLLKDLDLSKPITVEPIKG
LPCEKDLIVDMEPFFQSYREIMPFLVNEDHTPTGERFQSQEDRERFDDTTKCILCAACTS
SCPVFWTDGQYFGPAAIVNAHRFIFDSRDQAGDMRLEILNDKEGVWRCRTTFNCTEACPR
GIQVTKAIAEVKKAVFASAL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgcagtgaccgagaaccagaaccaggacgctcagcagcccgctcccgagggc
gaggagagcatccccacgtacgacgtcgtgctccgggtccgccgctacgatcccgagttc
gagtccgaggcccactgggacgagtggcccctcaccatgtacggcacggaccgggtgctg
gacgccctgcacaaggtcaagtgggaactcgacggctcgctgtccttccgtcgctcgtgc
gcccacggcgtgtgcggttcggacgccatgcgcatcaacggccgcaaccggctcgcgtgc
aagaccctgctcaaggacctggacctgtccaagcccatcacggtggagcccatcaagggc
ctgccgtgcgagaaggacctgatcgtggacatggagccgttcttccagtcctaccgcgag
atcatgccgttcctggtgaacgaggaccacacccccaccggggagcggttccagtcccag
gaggaccgcgagcgcttcgacgacaccaccaagtgcatcctgtgcgcggcgtgcacgtcc
tcgtgccccgtgttctggacggacgggcagtacttcggccccgccgcgatcgtcaacgcg
caccggttcatcttcgactcgcgcgaccaggcgggtgacatgcgcctggagatcctcaac
gacaaggagggtgtgtggcgctgccgcaccaccttcaactgcaccgaggcgtgcccccgt
ggcatccaggtgaccaaggccatcgctgaggtcaagaaggcggtcttcgcctccgccctg
tga

DBGET integrated database retrieval system