KEGG   Kocuria rhizophila: KRH_18440Help
Entry
KRH_18440         CDS       T00701                                 

Definition
(GenBank) hypothetical protein
Organism
krh  Kocuria rhizophila
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu_synthase FMN_dh
Motif
Other DBs
NCBI-ProteinID: BAG30191
NITE: KRH_18440
UniProt: B2GFQ3
LinkDB All DBs
Position
complement(2096759..2098675)
Genome map
AA seq 638 aa AA seqDB search
MRLLILGGLTLATLATVLAAVLGPWGWWFPAVLFLLLLLVAVRDATQRRHSVLRNFPVLG
HMRFFLEKIRPEIQQYFIERNYDGKPFDRDQRSLVYSRAKGFKGDKAFGTELDVNEPGYE
YFVQSVAPRAAPEDEHRVRLGGPDCRQPYDASLLNISAMSFGSLSKNAVLAMNKGAALGG
FAQETGEGGLTEYHLVHDADIIWEFGSGYFGTRDENGNFDPEQFRRKANLPQVKAVNIKL
SQGAKPGLGGVLPGAKVTAEIAAARGVPEGQTCISPASHSAFTTPRELIRFVARLRELSH
GKPVGFKLCVGSRVEFLAICKAMIEEGVTPDFIVVDGAEGGTGAAPLEYQDHVGTPLVEG
LILVHNALVGAGLRERIKLGCAGKITSGHDIVRHIIQGADFCMSARAMMMAVGCIQAQAC
HTNKCPVGVTTQNPRLYRALDVEDKGDRVERYHRLTVEEAGQIIATMGCDHPEELTREML
RRKVTATQSISYESLYQWLRPRELFEGVKGGWGEDWDYADPDRFSAGHPGKYVFHDRGPL
TPGGVVPAADREYAGVGGSSVGSARVRGAAASSSPGAVRTGDDAAPQDPADASPGASRRP
EGEPGTSPGAQHTRRDPAPEPGNVDPDDDSRSRNPGLA
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtctcctgatcctcggcggcctcacgctcgccaccctcgccacggtcctggcggcc
gtgctcggtccctggggatggtggttccccgccgtcctcttcctcctcctgctgctcgtg
gccgtccgggacgccacgcagcgcaggcactcggtgctgcgcaacttccccgtgctcggg
cacatgcgcttcttcctggagaagatccgaccggagatccagcagtacttcattgagcgc
aactacgacggcaagcccttcgaccgggaccagcgctccctggtctactcccgtgccaag
gggttcaagggggacaaggcgttcggcaccgagctggacgtcaacgagcccggctacgag
tacttcgtgcagtccgtggctccccgggccgctcccgaggacgagcaccgggtgcgcctg
ggcgggccggactgccggcagccctacgacgcgtccctgctcaacatctccgccatgagc
ttcggctcgctgtccaagaacgccgtgctggccatgaacaagggtgcggccctcggcggc
ttcgcccaggagacgggtgagggcgggctcaccgagtaccacctcgtccacgacgcggac
atcatctgggagttcggctccgggtacttcggcacgcgcgacgagaacggcaatttcgac
cccgagcagttccggcgcaaggccaacctgccccaggtcaaggccgtgaacatcaagctc
tcccagggcgccaagcccggcctcggcggtgtgctgcccggggccaaggtcacggcggag
atcgccgcggcccgcggcgtgcccgaggggcagacctgcatctccccggcgagccactcc
gctttcacgacgccgcgcgagctgatccgctttgtggcccggctgcgggagctctcccac
ggaaagcccgtcggcttcaagctgtgcgtgggctcccgcgtggagttcctggccatctgc
aaggccatgatcgaggagggggtcaccccggacttcatcgtggtggacggcgccgagggc
ggcacgggcgcggccccgctggagtaccaggaccacgtgggcaccccgctcgtggagggc
ctgatcctggtgcacaacgccctggtgggagcggggctgcgcgagcgcatcaagctcggg
tgcgccgggaagatcacctcgggccacgacatcgtgcgccacatcatccagggcgcggac
ttctgcatgagcgcccgggccatgatgatggcggtgggctgcatccaggcccaggcgtgc
cacaccaacaagtgtcccgtgggcgtcaccacgcagaacccgcggctctaccgcgccctg
gacgtcgaggacaagggcgaccgggtggagcgctaccaccgcctcacggtggaggaggcg
ggccagatcatcgccacgatgggctgcgaccaccccgaggagctcacccgggagatgctg
cgccgcaaggtgaccgccacccagtccatctcctacgagtccctctaccagtggctgcgc
ccgcgcgagctgtttgagggcgtcaagggcggatggggcgaggactgggactacgccgat
cccgaccgcttctcagcgggccaccccggcaagtacgtgttccacgaccgcgggccgctg
accccgggcggggtggtccccgccgcggaccgcgagtacgccggcgtgggcggctcctcg
gtgggctccgcgcgcgtacgaggtgcagcggcgtcgtcgtccccgggcgccgtgcggacg
ggcgacgacgccgcgccgcaggatcccgcggacgcctccccgggggcgagccgccggccg
gagggcgagcccgggacgagccccggcgcgcagcacacgcggcgggacccggctcccgag
cccggcaacgtggacccggacgacgactcacgctcccgcaaccccggcctcgcctga

DBGET integrated database retrieval system