KEGG   Ketogulonicigenium robustum: BVG79_00135Help
Entry
BVG79_00135       CDS       T04841                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase / fumarate reductase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
kro  Ketogulonicigenium robustum
Pathway
kro00020  Citrate cycle (TCA cycle)
kro00190  Oxidative phosphorylation
kro00650  Butanoate metabolism
kro01100  Metabolic pathways
kro01110  Biosynthesis of secondary metabolites
kro01120  Microbial metabolism in diverse environments
kro01130  Biosynthesis of antibiotics
kro01200  Carbon metabolism
Module
kro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kro_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
kro_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:kro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BVG79_00135 (sdhA)
   00650 Butanoate metabolism
    BVG79_00135 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BVG79_00135 (sdhA)
Enzymes [BR:kro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BVG79_00135 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BVG79_00135 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-ProteinID: ARO13495
UniProt: A0A1W6NW98
LinkDB All DBs
Position
132252..134057
Genome map
AA seq 601 aa AA seqDB search
MAAYTYETHEYDVVVVGAGGAGLRATLGMAEQGLRTACISKVFPTRSHTVAAQGGIAASL
GNMGPDSWQWHMYDTVKGSDWLGDTDAMEYLAREAPKAVYELEHYGVPFSRTEEGKIYQR
PFGGHTTEYGEGPPVQRTCAAADRTGHAILHTLYGQSLKQQAEFYIEYFAIDLIMSEDGV
CTGVLAWKLDDGTFHVFSAKMVVLATGGYGRAYFSATSAHTCTGDGGGMVARAGLPLQDM
EFVQFHPTGIYGSGCLITEGARGEGGYLTNSEGERFMERYAPTYKDLASRDVVSRCMTIE
IREGRGVGPNKDHIYLHLNHLPPETLHERLPGISESARIFAGVDLTKEPIPVLPTVHYNM
GGIPTNYWGEVLNPTAENPDRVQPGLMAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAI
RAGQIIQAGTPNPALNPHGIAKAFDRFDALRYANGSTTTADLRLEMQKTMQADAAVFRTD
KTLAEGVEKMAAVAAKVGDLKVTDRSLVWNSDLMETLELTNLMPNALATIVAAEARKESR
GAHAHEDYPNRDDVNWRKHSLAWVEGNNVSLAFRPVHLEPLTTVDEGGIDLKKIAPKARV
Y
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
gtggcagcttacacatacgagacgcatgaatatgacgtcgtggtggtcggcgctggtggc
gctggcctgcgtgcaacgctgggcatggccgaacagggcttgcgcaccgcttgtatttcc
aaggttttcccgacgcgcagccacacggttgcggcgcagggcggcattgcggccagcttg
ggcaacatgggccccgacagctggcagtggcacatgtatgatacggtgaagggcagcgac
tggctgggcgacactgatgcgatggaatatctggcccgagaggcccccaaggccgtgtac
gagctagagcactatggcgtgcccttcagccgcaccgaagaaggcaagatctaccagcgt
ccctttggtggccacacgaccgaatatggtgaaggcccgccggtgcagcgcacctgcgcc
gcggctgaccgcaccggccacgccattttgcacacgctttatggccaaagcctgaaacag
caggccgagttctacattgaatatttcgccatcgacctgatcatgtccgaagacggtgtc
tgcacgggcgttctggcgtggaaattggatgacggtaccttccacgttttttcggccaag
atggtcgtgctggcgacgggcggttacgggcgggcgtatttcagcgcgacctcggcccac
acctgcacgggcgatggcggtggtatggtggcccgcgctgggctgccgctacaggacatg
gaatttgtgcagttccacccgacggggatctacggctcgggctgtctgatcaccgaaggc
gcgcgcggcgagggtggttacctgaccaattcggaaggcgagcgttttatggaacgctac
gccccgacctataaagatcttgccagccgcgacgtggtttcgcgttgcatgaccatcgag
attcgcgaagggcggggcgtgggtccgaacaaagaccacatctatctgcacctgaaccac
ttgccgcccgaaacgctgcacgagcgcctgccgggcatttcggaatccgcgcgcattttc
gcaggtgttgacctgacgaaagagccgatccccgttctgccgaccgtgcactacaacatg
ggcggtattcccacgaactattggggcgaggttctgaaccccaccgccgagaaccccgac
cgcgtccagcccggcctgatggccgtgggcgaagcgggctgtgccagtgtgcacggggcg
aaccgcctcgggtcgaattcgttgatcgatctggtggtgttcgggcgggcggctgctatt
cgcgcgggccagatcattcaggcggggacgccgaatccggcgctgaacccgcacggtatc
gccaaggcgttcgatcgttttgatgcgctacgctatgccaatggcagcacgacgactgct
gatctgcggttggaaatgcaaaagacgatgcaggccgatgctgcggtgttccgcaccgac
aagaccttggccgagggggtcgagaagatggccgccgtcgccgccaaggttggcgatctg
aaggtgaccgaccgcagcttggtatggaacagcgatctgatggagacgctggagctgacg
aacctgatgccgaacgcgctggcgaccattgtggccgccgaagcgcgcaaggaatcgcgc
ggcgcccatgcccacgaagattacccgaaccgcgatgacgtgaactggcgcaagcactcg
ctggcatgggtcgaggggaacaatgtttcgctcgcctttcgtcccgttcacctcgagccg
ctgacgacagttgacgaaggcggtatcgacctgaagaaaatcgcgcccaaagcgcgtgtg
tactaa

DBGET integrated database retrieval system