KEGG   Ketogulonicigenium robustum: BVG79_00139Help
Entry
BVG79_00139       CDS       T04841                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase / fumarate reductase, iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
kro  Ketogulonicigenium robustum
Pathway
kro00020  Citrate cycle (TCA cycle)
kro00190  Oxidative phosphorylation
kro00650  Butanoate metabolism
kro01100  Metabolic pathways
kro01110  Biosynthesis of secondary metabolites
kro01120  Microbial metabolism in diverse environments
kro01130  Biosynthesis of antibiotics
kro01200  Carbon metabolism
Module
kro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kro_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
kro_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:kro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BVG79_00139 (sdhB)
   00650 Butanoate metabolism
    BVG79_00139 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BVG79_00139 (sdhB)
Enzymes [BR:kro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BVG79_00139 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BVG79_00139 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer2 Fer4_7 Fer4_9 Fer4_16 Fer4_18
Motif
Other DBs
NCBI-ProteinID: ARO13499
UniProt: A0A1W6NWB9
LinkDB All DBs
Position
135060..135839
Genome map
AA seq 259 aa AA seqDB search
MVQLTLPKNSRMTVGKTWPKPDGAVNVRKVQIYRWSPDDGENPRLDTYFVDLDTCGPMVL
DVLIKIKNEIDPTLTFRRSCREGICGSCAMNIDGQNTLACIYGLDEIRGDIRIYPLPHMP
VIKDLVPDLTHFYEQHASIMPWLETKTNTPQKEWRQSIEDRKKLDGLYECVMCASCSTSC
PSYWWNSDRYLGPAALLHAYRWIIDSRDEATGERLDELEDPFKLYRCHTIMNCAKTCPKG
LNPAEAIAHIKKMMVERVA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggtccaactgacactgcctaaaaacagccggatgacggttggcaagacgtggcccaag
cccgatggcgcagtaaacgtgcgcaaggtgcagatataccgttggtcacccgacgacggc
gaaaacccgcgccttgatacctatttcgttgatctggacacatgcggcccgatggttctg
gatgtgctgatcaagatcaagaacgagatcgacccgaccctgaccttccgccggtcgtgc
cgcgaagggatttgcgggtcctgcgcgatgaatatcgacgggcagaacacgctggcttgc
atttatgggctggacgagatcagaggcgatattcgtatctatccgctgccgcatatgccc
gtcatcaaggaccttgtgccggatctgacgcatttctacgagcagcatgccagcatcatg
ccttggctggaaaccaaaaccaacaccccgcagaaggaatggcgccagtcgatcgaggat
cgtaaaaagctggacggcctgtacgaatgcgtgatgtgcgcgtcgtgctcgacgtcttgc
cccagctattggtggaattccgaccgttacttgggccctgcggccctgctgcacgcttat
cgctggattatcgacagccgcgacgaggcaaccggagagcgtttggacgagctggaagac
ccgttcaagctgtatcgctgtcacaccatcatgaactgcgccaagacatgccccaagggt
ttgaacccggccgaggcgatagcgcatatcaagaaaatgatggtggaaagggtcgcctga

DBGET integrated database retrieval system