KEGG   Ketogulonicigenium robustum: BVG79_00495Help
Entry
BVG79_00495       CDS       T04841                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
kro  Ketogulonicigenium robustum
Brite
KEGG Orthology (KO) [BR:kro00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BVG79_00495 (ahpF)
Enzymes [BR:kro01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BVG79_00495 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_oxidored Thioredoxin_3 FAD_binding_2 DAO Thi4 FAD_binding_3 NAD_binding_7 AlaDh_PNT_C K_oxygenase NAD_binding_8 NAD_binding_9 FMO-like Glutaredoxin Phage_TTP_13
Motif
Other DBs
NCBI-ProteinID: ARO13849
UniProt: A0A1W6NXD4
LinkDB All DBs
Position
492915..494477
Genome map
AA seq 520 aa AA seqDB search
MLDTTMKAQLKAYLERLTRPVEITAFADDGAKSAEMLALLEDIRGLSDKITVARGAGADR
VPSFALTSPEQDIHLTFAGLPMGHEFTSLVLALLQVGGYPPKVEQALMDQIKHVKGSFHF
ETYFSLSCQNCPDVVQALNLMAVLNPGITHVAIDGALFQGEVEARQVMSVPTIFLNGAPF
GAGRMGPEEILAKIDIGAADRAAAALAEEAPFDVLVIGGGPAGAAAAVYAARKGVRTGVV
AERFGGQVLDTMAIENLISVPHTEGPQLARALETHVRQYDVQIMAAQAATALSAVDGGFR
VDLASGAALTATSVILSTGARWRKMGVPGEDQYLNKGVAFCPHCDGPLFKGKRIAVIGGG
NSGVEAAIDLAGLVSHVTLIEFDSVLRADDVLQRKLRSLPNVSVITQARTTEVLGDGTRV
TGLRYEDRQSGAVRDVALEGIFVQIGLVPNTDWLKGTLALTPRGEIEVDAHGATSLTGVF
AAGDCTTVPYKQIVIAMGEGAKASLAAFDHLIRLPLSSAA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacgaccatgaaagcgcagctcaaggcttatcttgagcgtttgacccgccct
gtagaaatcacggcttttgccgacgacggggcgaaatcggccgaaatgctggcgttgctc
gaggatatccgcggcctttccgacaagattaccgttgcgcggggcgctggggccgaccgc
gttccctcgttcgcgctgacatcgccggagcaggatattcacctgacctttgcgggtctg
ccgatggggcatgaattcacgtcgctggtcttggcgctgctgcaggttggggggtatccg
cccaaagtcgagcaggccttgatggaccagatcaagcatgtgaaaggtagcttccacttc
gagacgtatttttcgctatcctgtcagaactgccctgatgtggtgcaggcgctgaacctg
atggctgtgctgaaccccggcatcacccatgtcgcgattgatggggcgttgttccaaggt
gaggttgaggcgcggcaggtcatgtcggtgccgactattttcctgaacggtgcccctttt
ggtgcgggccgtatgggtcccgaggaaattctggccaagatcgacattggcgccgccgat
cgcgccgcggcagcactggccgaggaagcccccttcgatgtgctggtgattggcggcggg
cctgctggcgcggctgcggctgtctacgctgcgcgcaaaggcgtgcggacaggcgttgtg
gccgagcggttcggcgggcaagtgctggatacgatggcgatcgagaacctgatctcggtc
ccccacaccgaggggccgcaactggcccgcgcgctagagacgcacgtgcgccagtatgat
gtgcaaatcatggcggcgcaggcagcaacggcgctatccgccgtcgatggcggcttccgt
gtcgatctggcatcgggcgccgcactaaccgcgacgtctgtgatcctgtcgaccggcgcg
cgctggcgcaaaatgggcgtgccgggcgaggatcagtacctcaacaagggcgtggccttc
tgcccgcactgcgatgggccgttgttcaagggtaaacgaattgcggtgatcgggggcggt
aactcgggtgtcgaggccgcgatcgatctggctggccttgtgtcgcatgtcacgctgatc
gaattcgacagcgttctgcgggcggacgacgtgttgcagcgcaagctgcgcagcttgccg
aatgtgtcggtcatcacccaagcccgcacgaccgaggtgttgggcgacggcacccgcgtg
acgggcctgcgctatgaagatcgccagtcaggcgcggtgcgcgatgtggcgctcgagggg
attttcgtgcagatcggtttggtccccaataccgattggctgaaaggcacattggccctg
accccgcgcggcgagatcgaggtggacgcccatggcgcgacatcgctgaccggcgtcttc
gcggcgggcgattgcacgacggtgccgtataagcagattgtgattgcaatgggcgaaggc
gccaaggcgtcgcttgcggcttttgaccatcttatccgtttgcctttatcttctgcggct
tag

DBGET integrated database retrieval system