KEGG   Ketogulonicigenium robustum: BVG79_00630Help
Entry
BVG79_00630       CDS       T04841                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
kro  Ketogulonicigenium robustum
Pathway
kro00240  Pyrimidine metabolism
kro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BVG79_00630 (tdk)
Enzymes [BR:kro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BVG79_00630 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 AAA_19
Motif
Other DBs
NCBI-ProteinID: ARO13982
UniProt: A0A1W6NXL8
LinkDB All DBs
Position
complement(631801..632391)
Genome map
AA seq 196 aa AA seqDB search
MAKLYFNYSTMNAGKSTVLLQAAYNYNERGMQTYLLTAAFDNRAGVGRIESRIGIGADAD
TYLPDDDLFARIAQRMADGPIACVLVDEAQFLSPDQVWQLARAVDDLRVPVMCFGLRVDF
RGELFPGSATLLALSDEMREVRTICFCGKKATMVVRQGPDGQVAHDGDQVVIGGNETYVS
LCRRHWREAMGEVLPN
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagctctacttcaactactcgaccatgaatgcgggcaaatcgactgtcctgctg
caggcggcctacaactataacgaacgtggaatgcagacctatttgctgacagccgccttc
gacaatcgcgcgggggtcgggcgcatcgaaagccgcatcggaatcggcgccgatgccgat
acctacctgcccgacgacgacctgttcgcccgcatcgcccagcgcatggccgatggcccc
atcgcctgcgtgctggtggacgaggcgcagttcctgtcgcccgatcaggtgtggcaactg
gcccgcgctgtcgatgacctgcgcgtgcctgttatgtgctttggcctgcgggtggatttt
cggggcgagctgttccccggctcggcgacgctgctggccctatcggacgagatgcgtgaa
gtccgcacgatctgtttttgcggcaaaaaggccaccatggtggtgcgccaggggcctgat
ggtcaagtcgcccacgatggcgatcaggtggtgatcggcgggaacgaaacttatgtctcg
ctctgccgccgtcactggcgtgaagctatgggcgaggtgctacccaactaa

DBGET integrated database retrieval system