KEGG   Ketogulonicigenium robustum: BVG79_00933Help
Entry
BVG79_00933       CDS       T04841                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
kro  Ketogulonicigenium robustum
Pathway
kro00010  Glycolysis / Gluconeogenesis
kro00020  Citrate cycle (TCA cycle)
kro00620  Pyruvate metabolism
kro01100  Metabolic pathways
kro01110  Biosynthesis of secondary metabolites
kro01120  Microbial metabolism in diverse environments
kro01130  Biosynthesis of antibiotics
kro01200  Carbon metabolism
Module
kro_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BVG79_00933 (aceF)
   00020 Citrate cycle (TCA cycle)
    BVG79_00933 (aceF)
   00620 Pyruvate metabolism
    BVG79_00933 (aceF)
Enzymes [BR:kro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BVG79_00933 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 QRPTase_N RnfC_N DUF5525
Motif
Other DBs
NCBI-ProteinID: ARO14285
UniProt: A0A1W6NYG1
LinkDB All DBs
Position
complement(913831..915099)
Genome map
AA seq 422 aa AA seqDB search
MSIEILMPALSPTMEEGTIAKWLVSEGDTVKSGDILAEIETDKATMEFEAVDEGVIGKIV
LPAGSEGVKVNSLIAILLEDGETEVAAPKAAAPKAEAAPTPAPVTAAAPVAAPVEKGERV
FASPLARRIAADKGLDLNAIAGSGPHGRIVRADVENATAAPKAAAAAAPAPVAATPAASS
TAAEQILKMYQGRDYTEIKLDGMRKTIAARLTEAKQTVPHFYLRRSVNLDALMAFRADLN
AKLGPRGIKISVNDFVIKACATALQQVPKANAIFAGDRIVQMKASDVAIAVAVEGGLFTP
VIRDADSKSISALSHEMKDLAKRARDKKLQPQDYQGGSFSISNLGMFGVENFDAVINPPQ
GAILAVGAGIKKPIVGEDGEITTATLMSLTLSVDHRVIDGALGAHLLTAIVENLENPLTM
LA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattgaaatcctgatgcctgccctgtcccccacgatggaggaaggcaccattgcg
aaatggctggtgtccgagggcgacaccgtcaaatccggcgacattctggccgaaatcgaa
accgataaggccacgatggaattcgaggccgtcgacgaaggcgtcatcggcaagatcgtc
ctgccagcaggcagcgaaggggtgaaagtcaacagcctgatcgccattctgctagaagat
ggcgagactgaggttgccgcccccaaggccgcggcccccaaagccgaagctgcgccgaca
ccggcccccgttacggcggccgcgcccgtcgcagcaccggttgaaaagggcgagcgcgtc
ttcgcatcgccccttgcccgccgcatcgccgccgacaagggccttgacctgaacgccatc
gcgggcagcggcccccatggccgcatcgtccgcgcagacgtcgaaaacgcaactgccgcg
ccgaaagccgctgcagccgccgcgcctgcaccagttgccgccacaccggcagcatccagc
accgccgccgaacagatcctgaagatgtatcagggccgcgactacaccgagatcaagctg
gacggcatgcgcaagaccatcgccgcccgcctgaccgaggccaagcagaccgtgccgcac
ttctacctgcgccgctcggtcaacttggatgcgttgatggccttccgcgccgacctgaac
gcaaaactgggcccgcgcggcatcaagatctcggtgaacgatttcgtcatcaaggcctgc
gccaccgcgctgcaacaagtgccgaaagcgaatgcgatctttgccggcgaccgcatcgtg
cagatgaaggcgtcggacgtggccatcgccgtcgcggtcgagggtggcctcttcaccccc
gtcatccgcgacgcggacagcaaaagcatctcggccctctcgcacgagatgaaagatctg
gccaaacgcgcacgcgacaagaaactgcaaccccaagactatcagggcggcagcttctcg
atctcgaacctcggcatgttcggcgtcgagaatttcgacgccgtgatcaaccccccgcag
ggcgcaattctggctgtcggcgcgggcatcaaaaagcccatcgtgggtgaagatggcgaa
atcaccaccgccacgctgatgtcgctgacactctcggtcgaccaccgcgtgatcgatggt
gcgctgggggcccacctgctgaccgcgattgtcgaaaacctcgaaaatccgctgacgatg
ttggcataa

DBGET integrated database retrieval system