KEGG   Kocuria rosea: EQG70_03265
Entry
EQG70_03265       CDS       T06074                                 

Definition
(GenBank) aminotransferase class III-fold pyridoxal phosphate-dependent enzyme
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
krs  Kocuria rosea
Pathway
krs00250  Alanine, aspartate and glutamate metabolism
krs00410  beta-Alanine metabolism
krs00640  Propanoate metabolism
krs00650  Butanoate metabolism
krs01100  Metabolic pathways
krs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:krs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EQG70_03265
   00650 Butanoate metabolism
    EQG70_03265
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EQG70_03265
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EQG70_03265
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:krs01007]
    EQG70_03265
Enzymes [BR:krs01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     EQG70_03265
Amino acid related enzymes [BR:krs01007]
 Aminotransferase (transaminase)
  Class III
   EQG70_03265
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-ProteinID: QCY32004
LinkDB
Position
complement(709683..710954)
AA seq 423 aa
MTSLSPLLKQATPVVVDSARGCWISGTDGREYLDFTTGIGVTSTGHCHPRVVEAAREQVG
RVIHAQYTTVLHPPLLELTEKLGEVLPPGLDSVFYANSGSEAVEAAVRLARMATGRPNVV
VFQGGFHGRTVAAATLTTAGTRFSAGFSPLMGGVHMAPFPYAHRYGWDERTAVDFALREL
DYLLVTRTAPEDTAALLIEPVLGDGGYLPTPPAFLEGLRERADRHGILLVLDEVQAGVGR
TGRFWGHQFADVVPDVLITAKGLASGFPISAIAAPTALMERGWPGSQGGTYGGNAVAAAA
ACATLDVVRDEHLVENARVRGDQLQAGLRPLQQRYPGISDVRGRGLMQGVEFAQEDGSPD
AAAALAVQQATTGHGLLTLTCGPAGNVVRLIPALVVSEQEIRTGLERFEAALAEVLAGAA
ATA
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgacctcactgagtccgctcctgaagcaggcgaccccggtcgtcgtcgactccgcccgg
ggctgctggatctccggcacggacgggcgcgagtacctggacttcaccaccgggatcggg
gtgaccagcacgggccactgccacccccgggtggtcgaggcggcccgcgagcaggtcggc
cgggtcatccacgcccagtacacgaccgtgctgcaccccccgctgctcgagctcaccgag
aagctgggcgaggtcctgccgccgggcctggactccgtgttctacgccaactccggctcc
gaggcggtcgaggccgcggtgcggctggcccggatggccacgggccggcccaacgtggtg
gtcttccagggcggcttccacggccgcacggtggccgcggcgaccctcaccacagcgggc
acccggttctccgccggcttctccccgctcatgggcggggtgcacatggccccgttcccc
tacgcccaccgctacgggtgggacgagcggacggcggtcgacttcgccctgcgggagctg
gactacctcctggtgacccggacggcgcccgaggacaccgcggccctcctgatcgagccc
gtgctcggcgacggcggctacctgcccaccccgccggccttcctcgaggggctgcgggag
cgggcggaccggcacgggatcctgctggtgctggacgaggtgcaggccggggtggggcgg
accgggcggttctggggccaccagttcgcggacgtggtaccggacgtgctgatcaccgcg
aagggcctcgcctcgggcttcccgatctccgcgatcgcggcgccgaccgcgctgatggag
cggggctggcccggctcgcagggcgggacctacggcggcaacgccgtggccgccgcggcg
gcctgcgccaccctggacgtggtccgcgacgagcacctggtggagaacgcgcgggtccgc
ggggaccagctgcaggcggggctgcggcccctgcagcagcgctaccccgggatcagcgac
gtccgcggccgcgggctgatgcagggcgtcgagttcgcgcaggaggacggctccccggac
gccgccgccgcgctcgccgtgcagcaggccaccaccggccacgggctgctcaccctgacc
tgcgggccggccggcaacgtggtccggctgatccccgcactggtggtctccgagcaggag
atccgcacgggcctcgagcgcttcgaggccgccctggccgaggtcctcgccggggcggcg
gcgaccgcatga

DBGET integrated database retrieval system