KEGG   Kocuria rosea: EQG70_14285Help
Entry
EQG70_14285       CDS       T06074                                 

Definition
(GenBank) amino-acid N-acetyltransferase
  KO
K00619  amino-acid N-acetyltransferase [EC:2.3.1.1]
Organism
krs  Kocuria rosea
Pathway
krs00220  Arginine biosynthesis
krs01100  Metabolic pathways
krs01110  Biosynthesis of secondary metabolites
krs01130  Biosynthesis of antibiotics
krs01210  2-Oxocarboxylic acid metabolism
krs01230  Biosynthesis of amino acids
Module
krs_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:krs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    EQG70_14285
Enzymes [BR:krs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     EQG70_14285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_9 Acetyltransf_3 Acetyltransf_CG FR47 DUF4387
Motif
Other DBs
NCBI-ProteinID: QCY33893
LinkDB All DBs
Position
complement(3133885..3134412)
Genome map
AA seq 175 aa AA seqDB search
MTDLRLRPARTSDVPAIKDLVAPLARAGVLINKDTVAYYEGIQEFLVVEAVGDEQAGLVG
CGALHVMWEDLGEVRTLATSDEWRGRGVGRTLLAGLIERARAVGVSRVFCLTFEVDFFSR
HGFEVMPNQNQVHPDVFAELLRSHDEGVAEYLDLARVKPNTLGNTRMLLQLSPED
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacctgcgcctccgacccgcccgcacctccgacgtccccgccatcaaggacctc
gtggcccccctggcgcgcgccggggtgctgatcaacaaggacacggtcgcctactacgag
ggcatccaggagttcctggtggtggaggcggtcggcgacgagcaggccggtctcgtcggc
tgcggcgccctgcacgtgatgtgggaggacctgggcgaggtccgcaccctggccacctcc
gacgagtggcggggccgcggggtgggacgcaccctgctggccgggctgatcgagcgggcc
cgcgccgtgggggtctcgcgcgtgttctgcctgaccttcgaggtcgacttcttcagccgg
cacggcttcgaggtcatgcccaaccagaaccaggtgcaccccgacgtgttcgccgagctg
ctgcgctcgcacgacgagggcgtcgccgagtacctggacctcgcccgggtgaagcccaac
accctcggcaacacccggatgctgctccagctcagcccggaagactga

DBGET integrated database retrieval system