KEGG   Kosakonia sacchari: C813_02550Help
Entry
C813_02550        CDS       T03601                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ksa  Kosakonia sacchari
Pathway
ksa00061  Fatty acid biosynthesis
ksa00780  Biotin metabolism
ksa01100  Metabolic pathways
ksa01130  Biosynthesis of antibiotics
ksa01212  Fatty acid metabolism
Module
ksa_M00083  Fatty acid biosynthesis, elongation
ksa_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ksa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    C813_02550
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    C813_02550
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    C813_02550
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ksa01004]
    C813_02550
Enzymes [BR:ksa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     C813_02550
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     C813_02550
Lipid biosynthesis proteins [BR:ksa01004]
 Fatty acid synthase
  Component type
   C813_02550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AHJ73768
LinkDB All DBs
Position
complement(2266603..2267391)
Genome map
AA seq 262 aa AA seqDB search
MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSSIV
LECDVAKDESIDALFTDLAKTWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVALAKACREMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNGISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFNIAAMNELEIK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctttccggtaagcgcattctggtaactggcgtcgccagcaaactgtccatc
gcatacggcatcgcacaggctatgcaccgcgaaggcgctgagctggcattcacctaccag
aacgacaagctgaaaggccgcgttgaagagtttgccgcccagctgggttccagcatcgtt
ctggaatgcgatgtcgctaaagatgaaagcatcgacgccctgttcaccgacctggcaaaa
acctggccgaagtttgacggtttcgttcactccatcggtttcgcacctggcgatcagctg
gatggcgactacgtgaacgcggtaacccgcgaaggctttaaaatcgcccacgacatcagc
tcctacagctttgtggcgctggcgaaagcctgccgcgaaatgctgaacccgggttcagcg
ctgctgacgctctcttatctgggcgctgaacgtgcgatcccgaactacaacgtaatgggt
ctggcaaaagcttctctggaagcaaacgtccgctatatggcgaacgcgatgggtccggaa
ggcgtgcgtgttaacggtatctccgccggtccgatccgtacgctggccgcctctggcatt
aaagatttccgtaaaatgctggcacattgcgaagcggttaccccgattcgccgtactgtg
accatcgaggacgtgggtaactccgccgcgttcctgtgctccgatctctctgccggtatc
tccggtgaagtggttcatgtggacggtggtttcaacatcgctgccatgaacgagctggaa
attaaataa

DBGET integrated database retrieval system