KEGG   Kosakonia sacchari: C813_07425Help
Entry
C813_07425        CDS       T03601                                 

Definition
(GenBank) peptidase M15
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
ksa  Kosakonia sacchari
Pathway
ksa00550  Peptidoglycan biosynthesis
ksa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ksa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C813_07425
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ksa01002]
    C813_07425
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ksa01011]
    C813_07425
Enzymes [BR:ksa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     C813_07425
Peptidases [BR:ksa01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   C813_07425
Peptidoglycan biosynthesis and degradation proteins [BR:ksa01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   C813_07425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AHJ74585
LinkDB All DBs
Position
complement(3251267..3252469)
Genome map
AA seq 400 aa AA seqDB search
MTHFSLSLRSLVAGSALLMLFSPSLYAVEQTPGAPTVDARAWILMDYASGKVLAEGNADE
KLDPASLTKLMTSYVVGQALKAGKIHLTDTVTVGKDAWATGNPALRGSSLMFLKPGDQVS
VADLNKGVIIQSGNDASIAIADFVAGSQDSFVSLMNSYAQKLGLTNTTFKTVHGLDAPGQ
FSTARDMALLGKALIHDVPDEYAIHKEKEFTFNKIRQPNRNRLLWNTGMNVDGMKTGTTD
GAGYNLVASATQGDMRLISVVLGAKTDRIRFNESEKLLTWGFRFFDTVTPIKPDATFVSQ
RVWFGDESEAKLGAGEAGSITIPKGQLNNLKASYTLTQPELQAPLTKGQVVGTIDFQLNG
KTIEQRPLVVMEAVKEAGFIGRMWDFVLLKFHQWFGGWFS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacgcatttctctttatcccttcgcagcctggttgcgggctctgcgctgttgatgctt
ttctccccttcgttgtacgcggtggaacaaacgccgggtgcgcctaccgtcgatgcgagg
gcgtggatcctgatggattacgccagcggtaaggtgctggcagaaggcaacgctgacgag
aagcttgatcctgccagcctcacgaagctgatgaccagctatgtagttggccaggcgttg
aaagccggaaaaattcatctcactgatacagtgaccgtcggcaaagacgcctgggcgacc
ggtaacccggcgctgcgtggttcctcgctgatgttcctgaaacccggcgaccaggtttcc
gttgccgatctcaacaaaggcgtgattatccagtccggcaacgatgccagtatcgctatc
gcagatttcgtggcgggcagccaggactcattcgtaagcctgatgaacagctatgcgcaa
aaactcggcctgaccaataccacctttaaaacggtgcacggcctggatgcgccggggcag
ttcagcaccgcgcgcgatatggcgctgctcggcaaggcactgattcatgatgtgccggat
gagtatgccattcataaagaaaaagagttcaccttcaataaaatccgccagccgaaccgt
aaccggttgctgtggaacaccggcatgaacgtggatggcatgaaaaccggcaccaccgat
ggcgcgggttacaacctggtggcctcggcgacgcaaggtgatatgcgcctgatttccgta
gtgctgggggcgaaaacggaccgcatccgctttaatgagtcggaaaaattgcttacctgg
ggtttccgtttcttcgacacggtcacgcctattaaacctgacgcgacatttgtcagccag
cgcgtgtggtttggcgatgagagtgaagcgaaacttggcgcgggtgaagcaggatctatc
accattcctaaggggcaactgaataacctgaaagccagctacaccttaacgcagccggaa
ctgcaggctccgctgaccaaaggtcaggtggtgggcaccatcgattttcagttgaacggt
aaaacgattgagcaacgcccgctggtggtgatggaagcggtgaaagaggccggtttcatt
ggccggatgtgggattttgtgttgctgaaatttcatcagtggtttggcggctggttctcc
tga

DBGET integrated database retrieval system