KEGG   Kosakonia sacchari: C813_10165Help
Entry
C813_10165        CDS       T03601                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
ksa  Kosakonia sacchari
Pathway
ksa00330  Arginine and proline metabolism
ksa01100  Metabolic pathways
ksa01110  Biosynthesis of secondary metabolites
ksa01130  Biosynthesis of antibiotics
ksa01230  Biosynthesis of amino acids
Module
ksa_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ksa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    C813_10165
Enzymes [BR:ksa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     C813_10165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored NAD_binding_2 Sacchrp_dh_NADP Shikimate_DH FAD_binding_4 IlvN OCD_Mu_crystall GFO_IDH_MocA PDH NAD_Gly3P_dh_N 2-Hacid_dh_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AHJ75055
LinkDB All DBs
Position
3796219..3797025
Genome map
AA seq 268 aa AA seqDB search
MEKKIGFIGCGNMGKAIVGGLIASGQVLPGQIWVYTPSPDKVAALHDQFGVNAAQSAQEV
AQIADIVFGAVKPNIMVKVLNDIASSLNKETLVVSIAAGVTLDQLARALGHDRKIVRAMP
NTPSLVNAGMTSVTPNALVTPEDTADVLNIFRCFGEAEVIAEPMIHPVVGVSGSAPAYVF
MFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLESGKHPGELKDMVCSPGGTTIEAV
KVLEEKGFRSAVIEAIAACMAKSDKMSS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaaaatcggttttatcggctgcggtaacatgggaaaagcgattgttggcggc
ttgattgccagcggccaggtgctgccggggcaaatctgggtgtataccccgtcgccggat
aaagtggctgccctgcatgaccagtttggcgtgaacgccgcgcaaagcgcgcaggaagtg
gcgcagattgccgatatcgtctttggcgcagtcaaaccgaacattatggtgaaagtgctt
aacgatatcgcctccagcttgaacaaagagacgctggtggtctccatcgccgccggcgtt
acgcttgatcagttagctcgcgcactcggccacgaccgcaaaatcgtccgcgccatgcct
aacaccccgtcgctggtgaacgcgggcatgacctctgtgacgcctaacgcgctggtcacg
ccggaagataccgccgatgtgctgaatatcttccgctgctttggtgaagcggaagtgatt
gccgaaccgatgatccacccggtagttggtgtcagcggctctgcaccggcatatgtgttt
atgtttatcgaagcgatggccgatgctgctgtgctgggcgggatgccgcgcgcgcaggcc
tataaatttgccgcacaggcggtgatgggctcggcaaaaatggtactggaaagtggcaag
catccgggcgagcttaaagatatggtctgttcgcctggtggcaccaccattgaagcggta
aaagtgctggaagagaaaggtttccgctcggcggtgatcgaagcgattgccgcgtgtatg
gcgaagtctgacaaaatgagtagctaa

DBGET integrated database retrieval system