KEGG   Kosakonia sacchari: C813_10180Help
Entry
C813_10180        CDS       T03601                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ksa  Kosakonia sacchari
Pathway
ksa00730  Thiamine metabolism
ksa00790  Folate biosynthesis
ksa01100  Metabolic pathways
ksa02020  Two-component system
Module
ksa_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ksa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    C813_10180
   00790 Folate biosynthesis
    C813_10180
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C813_10180
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ksa04147]
    C813_10180
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ksa00537]
    C813_10180
Enzymes [BR:ksa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     C813_10180
Exosome [BR:ksa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C813_10180
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ksa00537]
 Enzymes
  C813_10180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: AHJ75058
UniProt: W6J1R7
LinkDB All DBs
Position
complement(3799177..3800607)
Genome map
AA seq 476 aa AA seqDB search
MENIKVKQSALFLALLPLMFTPAIYAETTSAPVLDNRAAQGDISTPGGARRLSGDQTAAL
RDSLIDKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYSLDKKT
GKPDYVTDSAASATAWSTGVKTYNGALGVDIHDKDHTTILEMAKAAGLATGNVSTAELQD
ATPAALVSHVISRRCYGPMVTSEKCALNALEKGGKGSITEQLLNARADVTLGGGAKTFSE
TATAGEWKGKTLREQAQARGYQLVGDASTLAAITEANQDKPLLGLFSDGNMPVRWEGPKA
SLHGNIDKPAVTCTPNAKRTDSVPTLAAMTEKAIDLLSKNEKGFFLQVEGASIDKQDHAA
NPCGQIGETVDLDEAVQKALEFAKKDGNTLVIVTADHAHASQIIPADTKAPGLSQALNTK
DGAVMAITYGNSEEESMEHTGTQVRIAAYGPHAGNVVGLTDQTDLFYTMKAALNLK
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggagaatattaaagtgaaacagagcgcattatttcttgcattattacctctgatgttt
acccctgctatttatgccgaaacgacctcggcaccggttcttgataatcgtgccgctcag
ggcgatatttccacgcctggcggagcccgccgtttaagtggtgatcaaaccgctgcgttg
cgtgattccctcattgataagcccgccaaaaatattattttgctgattggcgatggcatg
ggagattccgaaattaccgccgcgcgaaattatgccgaaggggctggtggattctttaaa
ggtattgacgcattgccgctgaccggccagtacacgcactattcgctggacaaaaaaacc
ggtaaaccggattacgtcaccgactccgccgcgtctgccacggcctggagcactggcgtg
aaaacctataacggcgcactcggcgtcgacattcacgataaagatcacaccaccattctg
gagatggccaaagccgccggtctggcaacgggtaacgtttctactgcggaactgcaagat
gctacgcccgccgcgctggtttctcacgttatctcacgccgctgctatggcccgatggtg
accagtgagaagtgtgcgctcaacgcgctggaaaaaggcggtaaaggttcgattaccgaa
caactgcttaacgcccgcgcggatgtcacgctgggcggtggcgcgaaaacctttagcgaa
accgccaccgccggtgagtggaaaggtaaaacgctgcgcgaacaggcgcaggcgcgcggt
taccaactggttggtgatgcctctacgcttgcggcgatcaccgaagcgaaccaggataaa
ccgctgctggggctgttctccgacggcaacatgccggtgcgctgggaagggccaaaagcc
tcactgcacggcaatattgataaacctgccgtgacctgtacgcccaacgcgaaacgcacc
gacagcgtaccaacactggctgcgatgacggaaaaagccattgatttgctcagcaaaaat
gagaagggcttcttcctgcaggtagaaggcgcatcaatcgataaacaggatcacgcggcg
aacccgtgcggtcagatcggcgaaacggtcgatctcgacgaagccgtgcagaaagctctg
gaatttgccaaaaaagatggcaatacgctggtgatcgtgacggcggatcatgcccatgcc
agccagatcattccggcagataccaaagcgccaggcttaagccaggcactgaataccaaa
gacggcgcggtaatggccatcacttacggcaactcggaagaggagtcgatggaacatacc
ggaacgcaggttcgcatcgcggcttacggcccgcatgcgggcaacgtggtggggctgacg
gatcagaccgatctgttctacaccatgaaagcagcgctgaatctgaagtaa

DBGET integrated database retrieval system