KEGG   Kosakonia sacchari: C813_10200Help
Entry
C813_10200        CDS       T03601                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ksa  Kosakonia sacchari
Pathway
ksa00473  D-Alanine metabolism
ksa00550  Peptidoglycan biosynthesis
ksa01100  Metabolic pathways
ksa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ksa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C813_10200
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C813_10200
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    C813_10200
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ksa01011]
    C813_10200
Enzymes [BR:ksa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C813_10200
Peptidoglycan biosynthesis and degradation proteins [BR:ksa01011]
 Precursor biosynthesis
  Amino acid ligase
   C813_10200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 NHase_alpha RimK PTS_2-RNA
Motif
Other DBs
NCBI-ProteinID: AHJ75062
LinkDB All DBs
Position
3803369..3804469
Genome map
AA seq 366 aa AA seqDB search
MAKLRVGVVFGGKSAEHEVSLQSAKNIVDAMDKSRFDVVLLGIDKQGQWHVSDANNYLLN
ASDPARIALNPSENSVALVPGIQQQQLIQAENSTPLPNVDVIFPIVHGTLGEDGSLQGML
RLANLPFVGSDVLASAACMDKDVTKRLLRDAGLSIAPFITLTRANRERISFSNVQAQLGL
PLFVKPANQGSSVGVSKVTNEAQYHAAVNLAFEFDKKVVVETGIKGREIECAVLGNDEPQ
ASTCGEIVLNSEFYAYDTKYIDDNGAQVVVPADIDPAINDKIRTIAVQAYQALGCEGMAR
VDVFLTPENEVIINEINTLPGFTNISMYPKLWQASGIGYSELITRLIELAIARHQVNSAL
KITVNN
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactgcgggtaggggtcgtctttggcggcaaatcagcggaacatgaagtgtcg
ttacagtcggcgaaaaatatcgtcgacgccatggataaatcacgctttgacgtggtgcta
ctggggatcgataaacaggggcagtggcatgtcagcgatgcgaataattacctgctaaac
gccagcgatccggcgcgtatcgccttaaacccctcggaaaatagcgtggcgctggtgccg
gggatccagcagcagcaactgatccaggcagaaaacagcacgccgcttccaaatgtcgat
gtgatcttcccgattgttcatggcacgctgggcgaagatggttcattgcagggcatgctg
cgtctggcgaacttgccgtttgtcggttccgacgtactcgcctctgcggcctgcatggat
aaagatgtcaccaagcgcctgttacgcgacgccgggctttccatcgccccgtttatcacg
ctcacacgcgccaatcgtgagcggattagcttcagcaatgtgcaagcccaactcggtttg
ccgctgtttgttaaacccgccaaccaggggtcctctgtgggggtcagcaaggtgaccaat
gaagcgcagtaccacgctgcggtcaacctggcgtttgagttcgataaaaaagtggttgtt
gaaaccggcatcaaaggccgtgagatcgaatgcgcggtgttgggcaatgacgagccgcaa
gccagtacctgtggcgaaatcgtgcttaacagcgagttttacgcctacgacaccaaatac
atcgatgacaacggggctcaggtggttgtgcccgccgacattgatccggcaatcaacgat
aaaatccgcaccattgccgtgcaggcttatcaggcgctgggttgtgaaggcatggcgcgc
gtagatgtgttcctgacgccggaaaacgaggtgatcatcaacgagatcaacacgctgcca
gggttcaccaatatcagcatgtacccgaaactgtggcaggcgagcggcattggttatagc
gagttaatcacgcgcctgattgagctggccattgcgcgccatcaggtcaacagcgcgctg
aaaattaccgttaacaattaa

DBGET integrated database retrieval system