KEGG   Kosakonia sacchari: C813_14790Help
Entry
C813_14790        CDS       T03601                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ksa  Kosakonia sacchari
Pathway
ksa00620  Pyruvate metabolism
ksa00680  Methane metabolism
ksa01100  Metabolic pathways
ksa01120  Microbial metabolism in diverse environments
ksa01200  Carbon metabolism
Module
ksa_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ksa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    C813_14790
  Energy metabolism
   00680 Methane metabolism
    C813_14790
Enzymes [BR:ksa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     C813_14790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF2764
Motif
Other DBs
NCBI-ProteinID: AHJ75836
UniProt: W6J6C0
LinkDB All DBs
Position
4751766..4754417
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKLLGDTIKDALGENILDRVETIRKLSKSSRAGNEASRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISAKGEAASNPEVIAQTIRKLKDQPNLNEA
TIIKAIESLSLELVLTAHPTEITRRTLIHKMVEVNNCLKQLDNSDIADYERHQLMRRLRQ
LIAQSWHTDEIRRNRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEENLNYKLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDVQLLISELSMVECTDELR
ELAGAEGAREPYRYLMKKLRGDLMATQAWLEARLKGQKLPKPAGLLTQNEQLWEPLYACY
KSLQACGMGIIANGELLDTLRRVKSFGVPLVRIDIRQESTRHTEALGELTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRQWEPSEETREVLDTCQVIAEAPRGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFALPVAPLFETLDDLNNADDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTSAIMEANLLPPPEPKSEWRHIMDEL
SDISCDMYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVEDGKQSELEAMCRDWPFFSTRLGMLEMVFSKADLWLAE
YYDQRLVKPELWTLGSELRKLLEADINVVLAIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRLAEEEGKEPDHRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgctttgcgtagtaatgtcagtatgctcggcaaactgctggga
gataccatcaaggatgctctcggcgagaacattctcgaccgggtagaaacaatccgtaag
ctgtcaaaatcttctcgcgccgggaatgaagccagccgtcaggaactgctcaccactttg
cagaatctgtccaatgacgaactgctgccagtggcacgcgcgtttagccagttcctgaac
cttgccaacaccgctgagcaataccatagcatttcagcgaaaggcgaagcggccagcaac
ccggaagtgattgcccagaccatcagaaaactgaaagaccaacccaatctcaacgaagcc
acgattatcaaagcgattgaatcactgtcgctggagctggtgctgactgcgcacccgacc
gaaatcactcgccgtacgctgatccacaaaatggtggaagttaacaactgcttaaagcag
ctggataacagcgatatcgccgattatgaacgccaccagctgatgcgccgcctgcgccag
ttgattgcccagtcctggcataccgatgaaatccgcagaaaccgcccgagcccggtagat
gaagccaaatggggctttgccgtggtagaaaacagcctgtgggaaggcgtgccaaattac
ctgcgcgagctgaacgaacagctggaagagaacctcaattacaaactgccggtggatttt
gttccggtgcgtttcacctcgtggatgggcggcgaccgtgacggcaacccgaacgttacc
gccgatatcacccgccatgtccttctgcttagccgctggaaagcaaccgatctgttcctg
aaagatgttcagttgctgatttccgagctgtcaatggtggagtgtaccgacgagctgcgc
gaactggcgggcgcagaaggcgcgcgcgaaccgtatcgctacctgatgaagaagctgcgc
ggcgatctgatggccactcaggcctggctggaagcgcgcctgaaaggccagaaattaccg
aaaccggccgggctgctgacgcaaaacgagcaactgtgggaaccgctctacgcctgttat
aaatcgctgcaggcctgtggtatgggcattatcgccaacggtgaactgctcgatacatta
cgccgcgtgaagagttttggcgtgccgctggtgcgcatcgacattcgccaggagagcacc
cgtcatacggaagcgctgggcgaattaacgcgctatttgggcattggcgactacgaaagc
tggtcggaagcagataaacaagcattcctgatccgtgaactgaattccaaacgtccgttg
ctgccgcgccagtgggagccaagcgaagagacccgcgaagtgctggacacctgccaggtg
atcgccgaggcgccgcgcggatctatcgccgcgtatgtgatctcaatggcgaagacacct
tcagacgtgctggcagttcacctgctgctgaaagaagccggtatcggttttgcgctgccg
gtcgcgccgctgtttgaaacccttgatgacctgaataacgccgacgacgtgatgacccag
ttgctgaatatcgactggtatcgcggctttatccagggcaaacagatggtgatgattggc
tactccgactcggcgaaagacgcgggcgtaatggccgcttcatgggcgcaatatcaggcg
caggacgcgttaatcaaaacctgcgaaaaagccggtattgaactgacactgttccacggt
cgcggcggctctattggccgtggcggcgcaccggctcacgccgcgctgctctcgcaaccg
ccaggcagcctgaaaggcggcttacgcgtcaccgaacagggcgagatgatccgcttcaaa
tacggtctgccggaagtcaccatcagcagcttgtcgctttataccagcgcgatcatggaa
gccaacctgctgccgccgccggagccgaaaagcgagtggcgccatattatggacgagctg
tcggatatctcctgcgatatgtaccgtggctatgtgcgtgaaaacaaagatttcgtaccg
tacttccgttccgccacgccggagcaggaactgggcaaactgccgctgggttctcgcccg
gcgaaacgtcgcccgaccggcggtgttgaatcgctgcgcgcgatcccgtggatcttcgcc
tggacgcaaaaccgcctgatgctgccagcctggctgggcgcgggtgcggcattacagaaa
gtggtggaagacggcaaacagagcgagctggaagccatgtgccgcgactggccgttcttc
tccacccgtctgggcatgctggagatggtgttctcgaaagccgacctgtggctggcagaa
tattacgatcagcgtctggtgaaacccgaactgtggacgctgggtagcgaactgcgcaaa
ctgctggaagcggatatcaacgtggtgctggcaatcgccaacgattcgcacttaatggcc
gatttgccgtggatcgccgaatctatccagctgcgtaatatctataccgacccactgaac
gtgttgcaggccgagctgctgcaccgctcgcgccttgcggaagaagaaggtaaagagccg
gatcatcgcgttgagcaagcgctgatggtcacgatcgccggggtggcggcgggtatgcgt
aataccggctaa

DBGET integrated database retrieval system