KEGG   Kosakonia sacchari: C813_21135Help
Entry
C813_21135        CDS       T03601                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ksa  Kosakonia sacchari
Pathway
ksa00250  Alanine, aspartate and glutamate metabolism
ksa00410  beta-Alanine metabolism
ksa00430  Taurine and hypotaurine metabolism
ksa00650  Butanoate metabolism
ksa01100  Metabolic pathways
ksa01110  Biosynthesis of secondary metabolites
ksa01120  Microbial metabolism in diverse environments
ksa02024  Quorum sensing
Module
ksa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ksa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    C813_21135
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C813_21135
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C813_21135
   00430 Taurine and hypotaurine metabolism
    C813_21135
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    C813_21135
Enzymes [BR:ksa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     C813_21135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AHJ76938
LinkDB All DBs
Position
1133179..1134564
Genome map
AA seq 461 aa AA seqDB search
MDGQYPGIDDIYASLELSSSLEKHHFPAKERDPRNVFAAVHDELMLDGNSRQNLATFCQT
WVDDEIRTLMDLSIDKNMIDKDEYPQTAEIESRCVHMLADLWHSPEAENTLGCSTIGSSE
AAMLGGLALKWRWRKKQAAAGKPTDKPNLICGPVQICWHKFARYFDVELREIPLQGQRLV
MNAEEVIKRVDENTIGVVPTMGVTFSCQYEPVKAVHDALDNLQQETGLDIPIHVDGASGG
FLAPFCAPDIQWDFRLPRVKSINASGHKFGLAPLGAGWVVWREAADLPEELIFNVNYLGG
NMPTFALNFSRPGGQVIAQYYNFLRLGREGYTKIHHACYQTAQYLAREIDKLGPFKILFD
GDSQQGIPALAWTLRTERAIGGYTLYDLADRLRSRGWQVPAYSMPAHREDLVIQRVLVRH
GVSHDLASLLVDDIKRALDYFSRHPVINPLSAEEASGFNHA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggatgggcaataccctggcatagatgatatttacgcctcactggaattatcttcgtcc
ctggaaaaacaccacttccccgctaaagaacgggatccgcgcaatgtctttgccgcagta
cacgacgaattgatgcttgacggtaactcacgacaaaatctggcaacgttctgccagaca
tgggtcgatgatgaaattcgcacattgatggatttgtctatcgacaaaaacatgatcgat
aaagacgaatacccgcaaacggctgaaattgagtctcgctgtgtacatatgctggccgat
ttatggcactcgccggaggcggaaaacacgctcggctgctcgacaattggttcatctgaa
gcggcaatgctcggcggtctggcgctgaaatggcgctggcggaaaaaacaagctgctgca
ggcaaacctaccgacaaaccgaacctgatttgcgggccagtgcaaatctgctggcacaaa
tttgcacgctattttgatgttgagctgcgcgaaattcccctgcaaggccagcggttagtg
atgaacgccgaagaggtgatcaaacgggttgatgaaaacaccattggcgttgttccgacg
atgggcgtcaccttctcatgccagtatgagccggtaaaagcggtgcatgatgcgctggat
aatctgcaacaggaaaccggccttgatattcccatccatgttgacggtgccagcggcggg
tttctggcgccgttttgcgcgccggatattcagtgggactttcgcctgccacgggtgaaa
tcgattaatgcctctggccataaattcggtcttgcaccgctgggcgccggttgggtcgta
tggcgcgaggccgccgatttaccggaagaactgatttttaatgttaactacctcggcggc
aacatgccgacgttcgctctcaacttttcacgacctggcgggcaggttattgcccagtat
tacaatttcctgcgtctggggcgggaaggttacacgaaaattcatcacgcctgttaccag
acagcgcagtatctggcgcgggaaatcgacaagcttgggccgttcaaaatcctgttcgat
ggcgacagtcagcaaggcattcccgcactggcgtggacgctgcgcaccgagcgcgccatt
ggcggatacaccctttatgaccttgccgatcgcctgcgcagccgtggctggcaggtgccc
gcctattcaatgccagcccatcgcgaagatttggttatccagagggtgctggtgcgccac
ggcgtaagccacgatctcgccagcttgctggtggacgatattaagcgcgcacttgactac
ttttcccgccatccggtcatcaacccgctcagcgcggaagaagccagtggttttaatcac
gcctga

DBGET integrated database retrieval system