KEGG   Kosakonia sacchari: C813_23820Help
Entry
C813_23820        CDS       T03601                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
ksa  Kosakonia sacchari
Pathway
ksa00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ksa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    C813_23820
Enzymes [BR:ksa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     C813_23820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Cellulase Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: AHJ77403
UniProt: W6J8J4
LinkDB All DBs
Position
1686085..1688142
Genome map
AA seq 685 aa AA seqDB search
MNKFAPLSPKVVSLLHGADYNPEQWENYPDIIGNDIAMMQQAKCNVMSVGIFSWSKLEPQ
EGVFNFAWLDEVIDKLYAAGIHIFLATPSGARPAWMSQKYPEVLRVGRDRVPALHGGRHN
HCMTSPVYREKTLKINTLLAERYANHPAVLGWHISNEYGGECHCALCQEKFRGWLKARYQ
TLENLNHAWWSDFWSHTYSDWSQIQSPAPQGEVSIHGLNLDWRRFNTAQVTDFCRHEVAP
LKAANAQLPVTTNFMEYFYDYDYWQLAEAIDFISWDSYPMWHRDKDETALACYTAMYHDM
MRTLKGGKPFVLMESTPSVTNWQPTSKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAVIDHVGHLDTRVGREVCALGDMLSKLTPVMGCRTDARVAIIFDQQNRWALDDA
EGPRNKGLEYEKTINEHYRPFWEKGIAVDVINADADLSRYQLVIAPMLYMVRDGFAERAE
AFVAAGGHLVTSYWTGVVNESDLCYLGGFPGPLRKLLGIWAEEIDCLDDNERNLVQGLAG
NEAGLQGPYQVRHLCELIHTESAQALATYRDDFYVGRPAVTVNHVGKGKAWHVASRNDLA
FQRDFFANIIDELALPRALQHDLPPGLVATARTDGESTFVFIQNFSAQQQAITLPGGYQD
CLSGSSVSGAMSLAPWDCRVVSRKA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttgcgcctttaagcccgaaggtcgtctcgctattgcatggcgcggactat
aacccggaacagtgggaaaactatcccgatattattggtaacgacattgccatgatgcag
caggcaaaatgcaatgtcatgtctgtcggaatattcagttggtcgaaactcgaaccgcag
gaaggggtatttaatttcgcctggctggatgaggttatcgataaattatatgccgccggt
atccatatatttctggcaacgccaagcggtgcgcgtccggcctggatgtcacaaaaatac
ccggaggtgctgcgggtcgggcgcgatcgcgttccggcgctgcacggcgggcggcataac
cactgcatgacgtcgccggtgtaccgggaaaaaacgctgaaaatcaatacgctgctggca
gagcgttacgcaaaccatcccgcggtactgggctggcatatttcgaatgaatatggcggc
gaatgccactgcgcgctatgtcaggagaaattccgcggctggctgaaagcacgttatcag
acgctggaaaacctcaatcacgcctggtggagcgatttctggagccacacctacagtgac
tggtcgcagatccagtcaccggcaccgcagggggaagtctccattcacgggctgaacctc
gactggcggcgttttaacaccgcgcaggtcaccgatttttgccgccatgaagtggccccg
ctgaaagccgctaacgcacaactgccggtgaccaccaattttatggagtatttctacgat
tacgactactggcaactggctgaagcaattgattttatctcctgggatagctacccaatg
tggcaccgggataaagacgaaacggcgctggcctgctacaccgccatgtatcacgacatg
atgcgcacgctgaaaggcggcaaaccctttgtgctgatggaatccacaccgagcgtcacc
aactggcagccgaccagcaagctgaaaaagccgggaatgcacattctctcctcgctgcag
gcggtggcgcacggtgccgattcggtgcagtacttccagtggcgtaaaagccgtggttcg
gtcgagaagttccatggcgcggttatcgatcacgtcgggcatctggatacgcgcgtgggt
cgtgaagtctgcgcgctgggcgacatgctcagcaaactcaccccggtaatgggatgccgt
accgatgcccgtgtggcgatcatcttcgatcagcagaaccgctgggcgctggatgacgcc
gaagggccgcgtaataaagggctggagtatgaaaaaacgattaacgagcactatcgaccg
ttctgggaaaaaggcattgccgtggatgtgatcaatgccgatgccgatctcagccgttat
caactggtgattgcgccgatgctgtatatggtgcgcgacggttttgccgaacgcgcagag
gcgtttgtcgcggcgggcggtcatctggtgacctcctactggaccggcgtggtcaatgag
agcgatctctgttatctcggcggtttccctggtccgctgcgcaaattgcttggcatctgg
gcagaagagattgattgcctggacgataacgagcgcaatctggtacagggactggcgggg
aatgaagccgggttacaggggccgtatcaggtgcgccatctgtgtgagttgatccacacc
gagagtgcgcaggcgctggcaacttaccgggatgatttctacgtcggtcgacccgccgtg
acggtcaatcatgtcggtaaaggtaaggcctggcacgttgcctcacgcaacgatctcgcc
ttccagcgtgatttcttcgccaacattattgatgagctggcgctgccgcgcgcgttgcaa
cacgatttgccgccaggcctcgttgccacagcgcgtaccgatggcgaaagcacctttgtc
tttatccagaactttagcgcccaacagcaggcgataacgctgcctggcggctatcaggat
tgtttatctggttcgtcggtcagcggcgcgatgtcgctcgctccctgggattgccgggtt
gtaagccgtaaagcgtaa

DBGET integrated database retrieval system