KEGG   Kosakonia sacchari: C813_25825Help
Entry
C813_25825        CDS       T03601                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ksa  Kosakonia sacchari
Pathway
ksa00250  Alanine, aspartate and glutamate metabolism
ksa00410  beta-Alanine metabolism
ksa00640  Propanoate metabolism
ksa00650  Butanoate metabolism
ksa01100  Metabolic pathways
ksa01120  Microbial metabolism in diverse environments
Module
ksa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ksa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C813_25825
   00650 Butanoate metabolism
    C813_25825
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C813_25825
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C813_25825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ksa01007]
    C813_25825
Enzymes [BR:ksa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     C813_25825
Amino acid related enzymes [BR:ksa01007]
 Aminotransferase (transaminase)
  Class III
   C813_25825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIA25233
LinkDB All DBs
Position
301182..302447
Genome map
AA seq 421 aa AA seqDB search
MKNNELNQRRLQATPRGIGVMCGFYAEKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
VMAAVEKQLQAFTHTAYQIVPYESYVSLAERINERVPVAGPAKTAFFSTGAEAVENAVKI
ARAYTKRPGIITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSIYHAQYPNALHGVSTD
EALKSLERIFKADIAPDQVAAILLEPVQGEGGFNVAPNDFMQALRTLCDSHGILLIVDEV
QSGFARTGKLFASEYYDVKPDLITMAKSLAGGLPLSAVAGRAEVMDAPAPGGLGGTYAGN
PLAIAAAHAVLDVIEEENLCERANHLGQHLVEVLNRAKAQCPYIADIRAQGSMVAVEFND
PQTGAPSAEFTKQVQEKALADGLLLLSCGVYGNVIRFLYPLTIPEVQFRKALDILSQSLT
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaacaacgaattgaatcagcgccgtttacaggcgacgccgcgcggcattggggtg
atgtgcggtttttacgccgaaaaagcggaaaacgcgacgctgtgggatgtagaagggaac
gaagtgatcgactttgccgccgggatcgcggtgcttaacaccggacatcggcatccaaaa
gtaatggcagcggtagaaaaacagttgcaggcatttacccataccgcttatcagattgtt
ccttacgaaagctatgtctcgctggcggagcgtattaacgaacgcgtgccggttgctggc
ccggcaaaaacagcgtttttctccactggcgcagaagcggtggaaaacgccgttaaaatt
gcccgcgcctataccaaacgccccggaattatcacctttggcggcggtttccacggtcgc
acctttatgaccatggcgctcaccggcaaagtcgcgccgtataaaattggtttcggcccc
ttccccggttcgatttaccacgcccagtatcccaacgcgctgcacggtgtgagcactgac
gaggcgctgaaaagcctggaacgtatttttaaagcggatatcgcgccggatcaggtggcc
gccattctgctggaacccgtacaaggcgagggcggttttaacgtcgcaccgaatgatttt
atgcaggcgctgcgcacgttgtgcgatagccacggtattctgctgatcgttgacgaagtg
cagagcggttttgcccgcaccggtaagctctttgccagcgaatattacgatgtgaaaccg
gatttaatcaccatggcgaaaagtcttgccggtggtttgccgctttcggcggtggccggg
cgtgcggaggtgatggatgcgcctgcaccgggtggtttgggcggcacttatgcgggcaat
ccgctcgctatcgcggcggcacatgcggtgctggacgtgattgaagaagaaaatctctgc
gaacgggcgaaccatctgggtcaacatctggtggaagtgctgaaccgcgcaaaagcgcaa
tgcccctatatcgctgatatccgtgcacagggctccatggtggcggtggaatttaacgat
ccgcaaaccggcgcgccatctgctgaatttactaaacaggtgcaggaaaaagcgctggcg
gacgggctgctgttgctgagctgcggggtttacggcaacgttattcgcttcctctacccg
ttaaccattccggaagttcagttccgcaaggcgctggatattctctcccagtcgctgacg
gattaa

DBGET integrated database retrieval system