KEGG   Kosakonia sacchari: C813_26280Help
Entry
C813_26280        CDS       T03601                                 

Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ksa  Kosakonia sacchari
Pathway
ksa00071  Fatty acid degradation
ksa00280  Valine, leucine and isoleucine degradation
ksa00281  Geraniol degradation
ksa00310  Lysine degradation
ksa00362  Benzoate degradation
ksa00380  Tryptophan metabolism
ksa00410  beta-Alanine metabolism
ksa00640  Propanoate metabolism
ksa00650  Butanoate metabolism
ksa00903  Limonene and pinene degradation
ksa00930  Caprolactam degradation
ksa01100  Metabolic pathways
ksa01110  Biosynthesis of secondary metabolites
ksa01120  Microbial metabolism in diverse environments
ksa01130  Biosynthesis of antibiotics
ksa01200  Carbon metabolism
ksa01212  Fatty acid metabolism
Module
ksa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ksa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C813_26280
   00650 Butanoate metabolism
    C813_26280
  09103 Lipid metabolism
   00071 Fatty acid degradation
    C813_26280
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    C813_26280
   00310 Lysine degradation
    C813_26280
   00380 Tryptophan metabolism
    C813_26280
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C813_26280
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    C813_26280
   00281 Geraniol degradation
    C813_26280
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    C813_26280
   00930 Caprolactam degradation
    C813_26280
Enzymes [BR:ksa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     C813_26280
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     C813_26280
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     C813_26280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AIA25292
LinkDB All DBs
Position
1485566..1487713
Genome map
AA seq 715 aa AA seqDB search
MTTTSAFTLNVRPDNVAVVAIDVPNEKMNTLKAEFATDVRAILKQIRDNKALRGVVFISA
KPDNFIAGADINMIARCQTAKEAEDLARQGQQLMAEIHALPIPVVAAINGPCLGGGLELA
LACHRRICTNDAKTVLGLPEVQLGLLPGSGGTQRLPRLIGVSTALEMILTGKQLRPRQAL
KVGLVDDVVPPSILLDAAVGLVSQGRPASRHLPVRERILAGPLGRTLLFRMVAKQTEQKI
QGNYPAASRILSVIETGLAQGRSSGYDAEARAFGQLAMTPQSQALRHLFFTSTDIKKDPG
SAVEPGPLNSVGVLGGGLMGGGIAFVTASKGGVPVRIKDINAKGINHALKYSWQQLDKKV
RRRYLKPAERDSQMAKISGSLDYRGFAHRDLVIEAVFEDLALKQKMVGEVEANCAAHTIF
ASNTSSLPIGDIAANATRPEKVIGLHFFSPVEKMPLVEVIPHAGTDEQTIATTVKLAKKQ
GKTPIVVADKAGFYVNRILAPYINEAMRLLSEGQRIETIDQALVKFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGERFSAPASVVNAILNDDRKGRKNERGFYLYPAKGRKSKKQPDPS
IYRLIGVSDGTQLPSQQIAERCVMLMLNEAARCFDEQVIRSARDGDVGAVFGIGFPPFLG
GPFHYMDALGVSEVVATLQRLQAQYGERFAPCEPLLRMAEQGVTFWPIKETERFS
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaacatcggcatttacccttaatgtgcgtcccgacaatgtggcggtagtcgct
attgatgtaccgaatgagaagatgaacacgctgaaagcggagttcgcgaccgacgtgcgc
gccatcctcaaacagatccgcgataacaaagcgttgcgcggcgtggtgtttatctcagca
aaaccggacaattttattgcgggcgcggatatcaatatgatcgcccgctgtcagacggcg
aaagaggccgaagatcttgcccgtcaggggcagcagttaatggcggaaatccatgcgctg
ccgatcccggtcgttgctgcgattaatggcccttgcctcggcggtgggctggaactggcg
ctggcgtgccatcgccggatttgtacgaacgatgccaaaacggtgctgggattaccggaa
gtgcagttgggcttgcttcccggctctggcggtacacagcgcttaccgcgcctgattggc
gtgagtaccgcgctggagatgatcctcaccggtaagcagttacggccacggcaggcatta
aaagtggggctggttgacgatgtggttccgccttccattttgctggacgccgccgtcggg
ctggtttcgcaggggcgtcctgccagccgtcatttaccggtgcgcgaacgcattcttgcc
gggccgcttggccgcactttattgttccgcatggtggcgaagcaaacggagcagaaaatc
caggggaattaccctgccgcgtcgcgcattctctcggtgattgaaaccggtcttgcccag
gggcgcagcagcggttatgacgccgaagcacgcgcgtttggccaactggcgatgacgccg
caatcgcaggcgctgcggcatctcttctttaccagtaccgatatcaaaaaagatcctggc
agcgccgtcgaacccggcccgcttaacagtgtgggagtgctgggcggtgggttgatgggc
ggcggtatcgcgtttgtcacggccagcaaagggggggtgccggttcgcattaaagatatt
aatgcgaagggcattaaccatgcgctgaaatacagttggcaacaactggataaaaaagtg
cgccgtcgttacctgaaacccgccgagcgcgacagccagatggcgaagatctccggttcg
ctcgattatcgtggcttcgcccaccgcgatctggtgattgaagcggtgtttgaggattta
gcgttgaagcagaaaatggtgggtgaagttgaagccaactgcgcagcgcataccattttc
gcgtccaatacctcgtctttaccgatcggcgatattgctgcgaatgcgacgcgtccggaa
aaagtcatcggattacatttttttagcccggtggaaaaaatgccgctggtggaggtgatt
ccccatgcaggcaccgatgagcagaccattgccacaacggtgaaactggcaaaaaaacag
ggcaaaacacccattgtggtggccgataaagcgggtttttacgttaaccgcatcctcgcg
ccttatattaatgaagcgatgcgtctgttaagcgaagggcaacgcattgaaacaatcgat
caggcgctggtgaaattcggttttcctgtgggccccatccagttgctggatgaagtgggg
atcgataccggcaccaaaattatccctgtgctggaagccgcatacggggaacgttttagc
gcgcctgcaagtgtggttaacgcaatcttgaatgatgatcgcaaaggcagaaaaaatgag
cgcggtttctatctttacccggcgaaagggcgtaaaagcaaaaagcagccagacccatcg
atctaccgcttaatcggtgtttcagatggcacacagttaccgtctcagcagatagcagaa
cggtgcgtgatgttgatgctgaacgaagcggctcgctgctttgatgaacaggtgattcgc
agtgcgcgcgatggtgacgttggcgccgtgtttggtatcggtttcccaccgtttttgggg
gggccattccactatatggatgcgctgggcgtaagcgaagtggtggcgacactacagcgg
ttacaggcgcagtatggcgagcgttttgcaccttgcgagccgctgttacgcatggcggaa
caaggtgtaactttctggccgataaaagaaactgaacgtttcagttag

DBGET integrated database retrieval system