KEGG   Komagataeibacter saccharivorans: CD178_00145
Entry
CD178_00145       CDS       T05634                                 

Definition
(GenBank) putative permease YjgP/YjgQ family protein
  KO
K07091  lipopolysaccharide export system permease protein
Organism
ksc  Komagataeibacter saccharivorans
Pathway
ksc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ksc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CD178_00145
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ksc02000]
    CD178_00145
Transporters [BR:ksc02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    CD178_00145
SSDB
Motif
Pfam: LptF_LptG
Other DBs
NCBI-ProteinID: AXY20975
UniProt: A0A347W7Y2
LinkDB
Position
144990..146222
AA seq 410 aa
MSRTSSLHRILGKLAPSTMDRYLLRQVVPPFSIALGVVMAALLLERLLVLFDILAANGSS
MKTFFGLLSDLIPHYLGLALPAAMCVSVFSVVRRMSANHEIDALTASGVSIFRICQPFVL
TGAVFGVLAFSLYGFIQPYARYDYRAAFYFASHAGWTPHLQSKMFAASDDVLLTAETVDH
AGSRLWHVFIRDNTDKAHVRLISAQKGYLYNPADGSRMRLDLVDGTIITDSQDKPPSITS
FTRTTRLISRDAKIDEEAYRNRGESERELTVPELYYGIKHGYPGISHSYMVAELHFRLAR
TIAIPFIPILACALAGVRKRQRGNPGLAIAAITLVGFDHTLQMGMSFVANMHMSPLLVMW
LPTFGFAIICTGMLIRQAGGLRILLTKGPALPPRELSADGLPRHIAKGRA
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgagccgcacgtcctctctgcaccggatattgggaaaactggcacccagcacgatggat
cgctatctgctgcgacaggtggtgccaccgttctccatcgcccttggcgtggtgatggct
gccctgctgctggaacggctgctggtgctgtttgacatcctggctgccaatggcagttcg
atgaagaccttcttcgggctgctcagtgacctgatcccccattatctgggtctggcgctg
cccgcggccatgtgtgtaagcgtgttttccgtcgtccggcgcatgagtgcgaatcatgag
atcgacgcactgaccgcaagcggcgtgtccattttccgcatatgccagccttttgtcctg
accggtgcggtattcggcgttctggctttttcgctttacgggttcatccagccctatgcg
cgctatgattatcgcgcggccttctatttcgccagccatgccgggtggacgccccacctg
cagtccaagatgttcgcggcatccgacgatgtcctgctgaccgctgaaacggttgaccat
gccgggtcgcggctgtggcatgtctttatccgcgacaacacggacaaggcgcatgtccgc
ctgatttccgcacagaagggttatctgtacaaccctgccgatgggtcgcgcatgcggctt
gatctggtggatggcaccatcataaccgacagtcaggacaagcccccctcgatcaccagt
ttcacccgcaccacgcgcctgatctcacgcgatgccaagatagatgaggaagcgtaccgc
aaccggggcgagagcgaacgcgaactgaccgtgccggaactgtattatggcataaagcat
ggctatccgggcatcagccattcctacatggtggccgaactgcatttccgtctggcgcgc
acgatcgccattcctttcattcccatactggcctgtgcactggcaggcgtgcgcaaacgc
cagcgtggcaaccccggtctggccattgccgccattacgctggtcggttttgaccatacc
cttcagatgggaatgagctttgtggccaacatgcacatgtcgcccctgctggtgatgtgg
ctgcccaccttcggctttgccatcatctgcaccggcatgctgatccggcaggctggcggg
ctgcgcatcctgcttaccaaagggcccgcgctgcccccccgcgagctttcggctgatggc
ctgccgcgccacattgcgaaaggtcgggcatga

DBGET integrated database retrieval system