KEGG   Komagataeibacter saccharivorans: CD178_00866
Entry
CD178_00866       CDS       T05634                                 

Gene name
mlaC
Definition
(GenBank) putative phospholipid-binding protein MlaC precursor
  KO
K07323  phospholipid transport system substrate-binding protein
Organism
ksc  Komagataeibacter saccharivorans
Pathway
ksc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ksc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CD178_00866 (mlaC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ksc02000]
    CD178_00866 (mlaC)
Transporters [BR:ksc02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Phospholipid transporter
    CD178_00866 (mlaC)
SSDB
Motif
Pfam: MlaC
Other DBs
NCBI-ProteinID: AXY21667
UniProt: A0A347W9X4
LinkDB
Position
929676..930290
AA seq 204 aa
MQTAIPRRHALALLATCAATPVASAWAVDALTQARSFVSMFGNKLVGIVNSDMPLEKKKQ
DILPLLNQYVDVDAIGRYCLGRYWRIATPEQQARYIKLFHEVLVNAITDKIGDYRGVTFV
VGTSAPSGDDTAVSTVINRPGQPGADTQWIISTASGSPKVVDVVGEGASLRLTQRQDYSS
FIARNSGNVDALLHALDKQIANHH
NT seq 615 nt   +upstreamnt  +downstreamnt
atgcagacagccatcccccgtcgccacgcactggctctgctggcaacctgtgccgccacg
cctgttgcctcagcatgggcggttgatgcactcacgcaggcccgttcctttgtctccatg
ttcggtaacaagctggtcggcatcgtcaacagcgacatgccactggaaaagaagaagcag
gacatcctgccccttctcaaccagtacgtcgatgtggacgccatcgggcgttactgcctt
ggccgctactggcgcatcgcaacccccgaacagcaggcacgctacatcaagctgttccat
gaagtgctggtcaacgccattaccgacaagatcggcgactaccgtggcgtgacattcgtg
gtcggcacaagtgccccgtccggtgacgatacggcggtgtccaccgtcatcaaccgtccc
ggccagccgggtgccgatacgcagtggatcatcagcaccgcaagcggcagccccaaggtc
gtcgatgtggtgggcgaaggcgcgagcctgcgcctgacgcagcggcaggactacagctcc
ttcatcgcgcgcaacagcggtaatgtggatgcgctgctgcatgcgctcgacaagcagatc
gccaaccaccactga

DBGET integrated database retrieval system