KEGG   Komagataeibacter saccharivorans: CD178_01129
Entry
CD178_01129       CDS       T05634                                 

Gene name
ptsO
Definition
(GenBank) Phosphocarrier protein NPr
  KO
K02784  phosphocarrier protein HPr
Organism
ksc  Komagataeibacter saccharivorans
Pathway
ksc02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:ksc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    CD178_01129 (ptsO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ksc02000]
    CD178_01129 (ptsO)
Transporters [BR:ksc02000]
 Phosphotransferase system (PTS)
  Enzyme I and HPr
   Phosphocarrier protein HPr [TC:8.A.8]
    CD178_01129 (ptsO)
SSDB
Motif
Pfam: PTS-HPr
Other DBs
NCBI-ProteinID: AXY21922
UniProt: A0A347WAM9
LinkDB
Position
1204466..1204765
AA seq 99 aa
MVADRMAQDTSHEAQARIVNQRGLHARAAARFVTVAEKFDATVDVIHVDMTVSGHSIMGL
MMLGAGRGETICIRTQGPQGPQALSALLRLVRAGFDEDD
NT seq 300 nt   +upstreamnt  +downstreamnt
atggtggctgatcgcatggcgcaggatacgtcgcacgaagcacaggcccgtatcgtgaac
cagcgcgggctgcatgcgcgcgccgccgcgcggtttgtgacggttgcggaaaaattcgac
gccacggtcgatgtcatccatgtggacatgacggtttcgggccattccatcatggggctc
atgatgctgggggcaggcaggggcgagacgatctgcatccgtacccaggggccgcagggt
ccgcaggcgctgtcggccctgctcaggctggtccgggccggctttgatgaagacgactga

DBGET integrated database retrieval system