KEGG   Komagataeibacter saccharivorans: CD178_01231
Entry
CD178_01231       CDS       T05634                                 

Gene name
mtsA
Definition
(GenBank) Metal ABC transporter substrate-binding lipoprotein precursor
  KO
K02077  zinc/manganese transport system substrate-binding protein
Organism
ksc  Komagataeibacter saccharivorans
Brite
KEGG Orthology (KO) [BR:ksc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ksc02000]
    CD178_01231 (mtsA)
Transporters [BR:ksc02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Putative zinc/manganese transporter
    CD178_01231 (mtsA)
SSDB
Motif
Pfam: ZnuA
Other DBs
NCBI-ProteinID: AXY22015
UniProt: A0A347WAX2
LinkDB
Position
complement(1313694..1314590)
AA seq 298 aa
MIVHRLFSLLGLCGLLSVAPVHAQARTLRAVASFTVLADVVTHVGGTHVTVTSLVPPDGD
PHEFEPSPDDARQLRQADIVFMSGEGLESWFGRLAHAASYHGQPVIVSSAIQAYTPPGAQ
QAETDPHVWNSVPNVVIWTNTIRDALIAADPEDADSFRASASAYVTQLQALDQDIRSRIS
AIPADRRRVLTSHDAFGYYGRAYGVTFMAPQGLSTETEASAGDVATLIRQIHQTGITTYF
MENATDPRLVQQVARATGAQPGGELYAEALSPPGGPAPDYITMMRHNTDLMVAAMRPR
NT seq 897 nt   +upstreamnt  +downstreamnt
atgatcgtgcatcgcctgttttccctgcttggcctttgcgggctgctatccgtcgccccc
gttcatgcgcaggcgcgtaccctgcgcgccgtcgccagctttacggtgctggccgatgtg
gtcacccatgtcggtggcacgcatgtcaccgtcacatcgttggtgccgcccgatggcgac
ccccacgaattcgaaccttcccccgatgatgcacggcagttgcgacaggccgatatcgtg
ttcatgagcggcgaaggactggaaagctggttcggacgactggcgcatgcggccagttat
catggccagcccgtcatcgtatccagtgccatacaggcctatacgccccccggcgcacag
caggccgaaaccgatccgcatgtatggaacagcgtgcccaacgtggtgatctggaccaac
accatccgtgacgccctgatcgcggcggacccggaggatgcggacagtttccgcgcatcg
gccagcgcctatgtcacgcagttacaggcgctggatcaggatatccgcagccggatatcc
gccatacccgcggaccgccggcgtgtcctgaccagccatgacgcctttggctattacggg
cgcgcctatggcgtcaccttcatggccccgcagggcctctcgaccgagaccgaagcctcc
gccggggatgtcgccacactgatccgccagatccaccagacaggtatcaccacctatttc
atggaaaacgccaccgacccccgccttgtgcagcaggtggcgcgggcaaccggcgcgcag
ccgggcggcgaactgtatgcggaagccctgtccccgcccggtggcccggcacctgactac
atcaccatgatgcgccacaataccgatctcatggttgcggcgatgcgtccgcgctga

DBGET integrated database retrieval system