KEGG   Komagataeibacter saccharivorans: CD178_01508
Entry
CD178_01508       CDS       T05634                                 

Gene name
phnT
Definition
(GenBank) Putative 2-aminoethylphosphonate import ATP-binding protein PhnT
  KO
K02052  putative spermidine/putrescine transport system ATP-binding protein
Organism
ksc  Komagataeibacter saccharivorans
Pathway
ksc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ksc00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CD178_01508 (phnT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ksc02000]
    CD178_01508 (phnT)
Transporters [BR:ksc02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Putative spermidine/putrescine transporter
    CD178_01508 (phnT)
SSDB
Motif
Pfam: ABC_tran TOBE_2 AAA_21 SMC_N AAA_29 AAA_30 AAA RsgA_GTPase
Other DBs
NCBI-ProteinID: AXY22285
UniProt: A0A347WBP2
LinkDB
Position
complement(1591894..1592958)
AA seq 354 aa
MTAFLSIRNLHKSYHGNVAVQNVSLDIRKGEFVTFLGPSGSGKSTTLYVIAGLMEPTGGD
VLVNGRTILDVPSNHRNIGMVFQKYTLFPNMTVRENIAFPLVVRKRPRDEIEARTNEMLR
LVRMEQLAGRYPAQMSGGQQQRVAIARAMVYEPEILLMDEPLSALDKKLREEIQGEIKRV
HERTGVTILYVTHDQEEALRLSDRIILFNTGRVEQIGTCTDLYTSPRSRFAGQFLGNSNF
MPVEIMDAAAGTIRLPGGACVENVRICDSGDVDHPLLMMRPEDLTFRKAGDCACSFDGQV
RSSYFLGNVMNYEIGIPGDYTLTMRVYIDGTEHPPQTGDRVSVGWLPHKAIVFR
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgacggcctttctcagcattcgcaatctccataaatcatatcacgggaatgtcgccgtc
cagaatgtctcgcttgatatccgtaagggggagttcgtgacattcctcggcccgtccggg
tcaggaaaaagcacgaccctgtatgtgatcgcgggccttatggagccgaccggcggcgac
gtgctggtcaatggacgcaccattctggatgtgccgtccaaccaccgcaatattggcatg
gtgttccagaaatacacgctctttcccaacatgaccgtgcgcgagaacattgcctttcca
ctggtcgtgcgcaaacgcccccgcgatgaaattgaagcccgcacgaacgaaatgctgcgg
ctggtcaggatggaacagcttgccggacgttaccccgcgcagatgtcgggcgggcagcag
cagcgcgtggccattgcccgcgccatggtctatgagcctgaaatcctgctgatggatgaa
cccctttcggcgctggacaagaaactgcgcgaggaaatacagggcgagatcaaacgcgtg
catgaacgcacgggtgtcacgatcctgtatgtcacccacgatcaggaagaagccctgcgc
ctgtcggaccgcatcatcctgttcaataccggcagggtggaacagatcggcacctgcacc
gatctgtatacatccccgcgtagcaggtttgcggggcagttccttggcaattccaatttc
atgcctgtcgagatcatggatgcggcagcaggcacgatcaggctgcccggtggggcatgt
gttgaaaacgtccgtatctgcgacagtggggatgtagaccatccgctgcttatgatgcgg
ccggaggatctgacctttcgtaaggccggagactgtgcctgttcgtttgatggacaggtc
aggagttcgtatttccttggcaatgtcatgaattacgaaataggaattcccggcgattac
accctgacaatgcgtgtttacattgatggcaccgaacacccaccccagacgggcgacagg
gtatcggttggctggctaccccataaggccattgttttccggtaa

DBGET integrated database retrieval system