KEGG   Komagataeibacter saccharivorans: CD178_01509
Entry
CD178_01509       CDS       T05634                                 

Gene name
phnV
Definition
(GenBank) Putative 2-aminoethylphosphonate transport system permease protein PhnV
  KO
K02053  putative spermidine/putrescine transport system permease protein
Organism
ksc  Komagataeibacter saccharivorans
Pathway
ksc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ksc00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CD178_01509 (phnV)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ksc02000]
    CD178_01509 (phnV)
Transporters [BR:ksc02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Putative spermidine/putrescine transporter
    CD178_01509 (phnV)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: AXY22286
UniProt: A0A347WBP3
LinkDB
Position
complement(1592955..1593752)
AA seq 265 aa
MLLSFENLGPWRIALGIIAALVTAFLVCPLVLIVMLSFDSSPWLVFPPPHWTLRWYRELF
TDPDWLGSFMVSLEVGLTVTVLSVLLGLITAIGISRTRTAWRPACETAFLMPMILPVVVT
AIALYAFFLRIHLNGTFCGFVIAHLILALPFSVGAILNGLAHIDPAIENAAVLCGSSRTY
AIMRITLPSLRPALFSAAIFSFLASWDEVVVAIFMASPSLQTVPVRIWGNLQQDLSPVIA
AVSTVLIVLSGLFIFGANFMKSEKK
NT seq 798 nt   +upstreamnt  +downstreamnt
atgctgctttccttcgaaaaccttggcccatggcggatcgcgctgggcatcattgccgcc
cttgtaaccgcttttcttgtctgtccgctggtgctgatcgtgatgctgtcattcgactca
tcaccatggctggtctttccgcccccgcactggacgctacggtggtaccgcgaactgttt
acggacccggactggctgggttccttcatggtcagcctggaggtcggtcttaccgtcacc
gtgctgtccgtccttctgggcctgataacggccattggcatatcgcgcaccagaacggcg
tggcggccggcgtgtgagacggcgttcctcatgcccatgatcctgccggtcgtggtgacg
gcaatcgcgctctatgcgttctttctgcgtatccatcttaacggcacgttctgcgggttc
gtgattgctcacctgatcctcgccctgcctttttcggtcggggccatcctgaacgggctt
gcacatatcgatccggcgattgaaaacgccgccgtgctgtgtggttcgtcccgtacctac
gcgatcatgcgtattacgctacccagcctgcggccggcgctgttttcggctgcgatcttt
tccttccttgcatcatgggatgaagtcgtggtggccattttcatggccagcccgtcactt
cagaccgtgccggtccgcatatggggcaatctgcagcaggatctctcgcccgtcatcgcc
gcagtatcgaccgtgctgattgtactgagcgggctgttcatattcggcgccaatttcatg
aaaagtgagaaaaaatga

DBGET integrated database retrieval system