KEGG   Komagataeibacter saccharivorans: CD178_01692
Entry
CD178_01692       CDS       T05634                                 

Gene name
gstB
Definition
(GenBank) Glutathione S-transferase GST-6.0
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ksc  Komagataeibacter saccharivorans
Pathway
ksc00480  Glutathione metabolism
ksc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ksc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CD178_01692 (gstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ksc02000]
    CD178_01692 (gstB)
Enzymes [BR:ksc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CD178_01692 (gstB)
Transporters [BR:ksc02000]
 Other transporters
  Pores ion channels [TC:1]
   CD178_01692 (gstB)
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_C_3 GST_C GST_N GST_C_2
Other DBs
NCBI-ProteinID: AXY22455
UniProt: A0A347WC62
LinkDB
Position
complement(1792085..1792714)
AA seq 209 aa
MAVHWMLIEIGAPFETVLVDLASGGQQTAAYRRLNPAGRVPTLVVDGSAHGESAALLMLL
AERHPEAALMPAPGSADRATWLEIMIQLANTLLPAMRDWFYADTDGEPIGADAVRSLARR
RIETAWDHLDRRLSSSQSHLVSDRLSTADFLAIMLMRWARNMPRPATTWPNLSAYIERVT
QRPSFIEVNRREGLANWPMSLDLPEQDGR
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcggtgcattggatgctcatagagatcggtgcaccgttcgaaacggttctggtcgat
cttgcatcgggcgggcagcagaccgccgcatatcgtcgtctaaacccggcgggtcgggtg
ccaacccttgtcgtggatggtagtgcgcatggtgagtcggccgcgctgctgatgcttctg
gccgaacgccatcccgaggcggcattgatgccggctcccggttctgcggacagggcaacc
tggcttgaaatcatgatccagcttgccaacacactgcttcctgccatgcgcgactggttt
tatgccgatacggatggggagccgatcggggcggatgctgtccgttctcttgcgcgtcga
aggatcgaaaccgcgtgggatcatctcgacaggcgactatcatccagccagtcccatctg
gtcagcgaccggctcagtacagcagattttctggccatcatgctgatgcgatgggcacgc
aacatgcctcgtccggccacaacatggcccaacctcagtgcctatatcgagcgcgtaacg
caaagaccttcctttatcgaggtcaatcgacgcgaggggcttgccaactggcccatgtcc
ctggacctgcctgagcaggatgggagataa

DBGET integrated database retrieval system