KEGG   Komagataeibacter saccharivorans: CD178_01796
Entry
CD178_01796       CDS       T05634                                 

Gene name
ccmF
Definition
(GenBank) Cytochrome c-type biogenesis protein CcmF
  KO
K02198  cytochrome c-type biogenesis protein CcmF
Organism
ksc  Komagataeibacter saccharivorans
Brite
KEGG Orthology (KO) [BR:ksc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ksc02000]
    CD178_01796 (ccmF)
Transporters [BR:ksc02000]
 Other transporters
  Others
   CD178_01796 (ccmF)
SSDB
Motif
Pfam: CcmF_C Cytochrom_C_asm
Other DBs
NCBI-ProteinID: AXY22557
UniProt: A0A347WCG4
LinkDB
Position
complement(1911038..1913017)
AA seq 659 aa
MNPELGNFALALACCMAAGQAILPLIGANRRDARLMALAPALAVGQMLALATSFACLIHA
AITNDFSAQNVAANSAVSKPLLYKITGVWGNHEGSVLLWALILSICGGAVALFGRNLPSA
LQARVIAVLGGVAAGFELFCLTTSNPFARVWPAPLDGQGMNPLLQDPGLAFHPPILYTGY
VGFAVPFAFAIAALIEGRVDAAWGRWVRPWAVAAWCFLTCGIAMGSWWSYYVLGWGGYWF
WDPVENASLIPWLTGTALVHSAIVVEKREALKIWTVLLAIGTFSFSLSGTFLVRSGILNS
VHAFANDPARGVFILGLLAVVIGGSLLLFAIRAPQLTTGGLFAPMSREGLLVLNNILLCS
ICAVVLTGTMYPPFMSLLFGKTISVGKPFFDATTIPLAIPLMVFMGFGPMVPWKRAQMWP
VLRRLWWAACVSLLALAVATFRMRDILPVLATATAVWVICSSVADIVERLRLFRQSPAQS
WQRARGLPRAVFGAALAHAGVGITVLGIAGMSQAAHRIVEVHVGQSEMLAGDSWTLTEVH
PAQGPNYTALVATIEVRHDGRLITTLHPSKRTFASQHQTTTEVAIHTNLMADIYGVLGDR
HGSDADPTYVLRLHYNPLAPWMWLGGLIMAFGGALSLSDRRVRVGAPRRAKAADMVAAR
NT seq 1980 nt   +upstreamnt  +downstreamnt
atgaacccggaacttggaaattttgcactggcactggcatgctgcatggccgccggacag
gccatcctgccgctgatcggcgcgaaccggcgtgacgcgcgcctgatggcgctggccccc
gcgctggccgtggggcagatgctggcccttgcgacttctttcgcatgcctgatccatgcg
gccatcaccaacgacttttccgcgcagaacgtggcggccaacagcgcggtcagcaagccg
ctgctgtacaaaatcaccggcgtatggggcaatcatgaaggctcggtgctgttatgggcg
ctgatcctgtccatctgcggtggcgcggtggccctgttcgggcgcaacctgccttccgcc
ctgcaggcacgcgtgattgcggtgctgggcggggttgcagcaggcttcgaactgttctgc
ctgaccacgtccaacccgttcgcccgtgtctggcccgcgccgctggacgggcagggcatg
aacccgctgctgcaggaccccggcctcgcgttccatccgcccattctctacaccggctat
gtcggcttcgccgtgccgttcgccttcgccatcgccgccctgatcgaagggcgtgtggat
gccgcatggggccgctgggtgcgcccgtgggcagtggcggcatggtgcttcctgacctgt
ggcatcgccatgggatcgtggtggtcctattacgtgctgggctggggtggctactggttc
tgggacccggtggaaaacgcatcgctgatcccgtggctgacgggcacggcgctggtgcat
tccgccattgtggtggaaaagcgcgaggcgctgaaaatctggactgtcctgctggccatc
ggcacgttttccttctcgctttccggcacgttccttgtgcgttcgggcatcctcaattcc
gtgcatgccttcgccaacgatccggcgcgtggcgtgttcatcctcgggctgcttgcagtg
gtcattggcggatcgctgctgctgttcgccatccgcgcgccgcagctcaccacgggtggc
ctgttcgcccccatgtcgcgtgaagggctgctggttctcaacaacatcctgctgtgttcc
atctgcgcggtggtactgacgggcacgatgtatccgccattcatgtcgctgctgttcggc
aagaccatttcggtgggcaagccgttctttgatgcgaccaccattccccttgccattccg
ctcatggtgttcatgggttttggcccgatggtgccgtggaagcgtgcgcagatgtggccg
gtcctgcgccgcttgtggtgggcggcctgcgtgtcgctgctggcgctggctgtcgccacc
ttccgcatgcgtgacatcctgccggtgctggcgaccgctaccgccgtatgggtgatctgc
agcagtgtcgccgatatcgtggaacggctgcgcctgttccgccagtcacccgcgcagagc
tggcagcgtgcccgtggtctgccgcgtgcggtattcggcgcagcgctggcccatgcgggt
gtcggcattacggtgctgggcattgcgggcatgtcgcaggcggcgcaccgcattgtcgaa
gtccatgtcggccagagcgagatgctggcaggcgatagctggaccctgaccgaagtccat
cccgcgcagggccccaattacaccgcgctggtcgccaccatcgaggtccgccacgatggc
aggctgatcaccaccctgcatccgtccaagcggacattcgccagccagcaccagaccacc
acggaagtggcgatccacaccaacctcatggccgacatctatggcgttcttggggacagg
cacggcagcgatgccgaccccacctatgtcctgcggctgcattacaacccgctggccccg
tggatgtggctgggcggcctgatcatggcctttggcggcgcgctgtcgctgtctgaccgt
cgtgtgcgcgtgggcgcgccgcgccgggcgaaggcggctgatatggtggcggcacgatga

DBGET integrated database retrieval system