KEGG   Komagataeibacter saccharivorans: CD178_02000
Entry
CD178_02000       CDS       T05634                                 

Gene name
sufC
Definition
(GenBank) putative ATP-dependent transporter SufC
  KO
K09013  Fe-S cluster assembly ATP-binding protein
Organism
ksc  Komagataeibacter saccharivorans
Brite
KEGG Orthology (KO) [BR:ksc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ksc02000]
    CD178_02000 (sufC)
Transporters [BR:ksc02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Orphan ABC ATPase
    CD178_02000 (sufC)
SSDB
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_29 AAA_25 Cytidylate_kin AAA_13 AAA_23 RsgA_GTPase AAA_33
Other DBs
NCBI-ProteinID: AXY22760
UniProt: A0A347WD17
LinkDB
Position
2124687..2125460
AA seq 257 aa
MSKQFVSIDGLCARISDGGTHKEILRGVDLQIPAGEVHAIMGPNGSGKSTLSYVLAGRED
YEVTGGGATFKGQDLLALEPEERAALGLFLAFQSPVELPGVNNANFLRTAVNAVRRARGQ
EELDAVAFLKAVRKETKHLSMSDEMLKRNVNVGFSGGEKKRNEVLQMRMLQPSFAILDET
DSGLDIDALRIVAEGVNSLRAPDFSALVITHHQRLLDYIVPDRIHVMARGRIIHSGGPEL
AKQLEAQGYARFLAEAA
NT seq 774 nt   +upstreamnt  +downstreamnt
gtgagcaagcaattcgtaagcattgatggcctgtgcgcccgcatttcggacggtgggacc
cataaggaaatcctgcgcggtgtcgacctgcagattccggcgggtgaggtccatgccatc
atgggccccaacgggtcgggcaagtcgaccctgtcctatgtactggcgggccgtgaggac
tacgaagtcacgggcggcggtgccacgttcaaggggcaggacctgctggcccttgagccg
gaggagcgcgcagcccttggcctgttccttgcctttcagtcccctgtggaactgccgggt
gtgaacaatgccaatttcctgcgtaccgccgtcaatgcggtccgccgcgcgcgcggacag
gaagaactggatgcggtggctttcctcaaggccgtgcgcaaggaaaccaagcatctgtct
atgtcggacgagatgctcaagcgcaatgtgaatgtcggcttttcgggcggcgagaagaag
cgcaacgaagtgctgcagatgcgcatgctccagccttccttcgccattctggacgaaacg
gatagcggactggacatcgatgcgctgcggatcgtggccgaaggcgtgaattccctgcgc
gcaccggatttttccgcccttgtcatcacccatcaccagcgcctgctggactatatcgtc
ccggaccgcatccatgtgatggccaggggccgcatcattcatagcggtggcccggaactg
gccaagcagcttgaggcgcagggctacgcgcgcttcctggcggaggcagcgtga

DBGET integrated database retrieval system